KEGG   Thielavia terrestris: THITE_2146152Help
Entry
THITE_2146152     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ttt  Thielavia terrestris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(2164799..2165358,2165421..2166351,2166490..2166646,2167209..2167321))
Genome map
AA seq 586 aa AA seqDB search
MPRYCASPSAPRKARPRKGASCGSPCSNTRMRSSWLVNSEDSDRRAEEEDAALHGAPAAP
SAARRTTGLREIFLFTWALLATAAVIVLAVRNLIFMVSDGMGPASLSLTRSFRQHVSSLP
IDDVLTLDRHFWGTSRTRSTNSLVTDSAAGATAFACGRKSYNGAIGMLPGARPCGTVLEA
AKRAGLATGLVVTTDVTDATPACFAAHVDYRLRQDEIALQEVGEGVLGRSVDLILGGGRC
HFLANHTRGSCRADDVDVVGIAREKHGWVYKSDRKGFDELAMGRNVSLPLLGLFAASDVP
FEIDRQNMADVYPSLSEMTATALTALHEATKDSDQGFFLMIEGSRIDHAGHINDPAAQVR
EVLEYDRTFQIVLDFLEQSQTEGVLVATSDHETGGLATAWQAPNELPVYDWYPAVLAKAN
ASAEYCSLLLQQHLASISSSSSDGSPPSKKSLIDWINQELVVRRLGITDARDAELAALAA
KPEAATHIFSRMVSVRAHVGWSTHGHSAIDVNIYSSGGPGTERLRGNVENTEVGKFLSEY
LGVDVGEITKELEEKLKGRPAGREVEVQREVETRVHPEEWFREMGI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggtactgcgccagcccgtcggcgccgcggaaggcgcgccccaggaagggcgcc
agctgcgggagcccgtgctcgaacacgaggatgcggtcgtcctggctggtgaactccgaa
gactcggaccgccgcgccgaagaagaagatgccgctctgcatggcgctccggcagcgcct
tccgcggcccgccgcaccaccggcttgcgcgagatcttcctcttcacctgggcgctgctt
gccaccgcggccgtgatcgtgctcgccgtccgcaacctcatcttcatggtctcggacggc
atgggcccggcctcgctcagcctgacgcgctccttccggcagcacgtctcgtcgctgccg
atcgacgacgtgctgacgctggaccgccacttctggggcacgtcgcgcacgcgctcgacc
aacagcctggtgaccgactcggccgccggcgcgaccgccttcgcctgcggccgcaagagc
tacaacggcgccatcggcatgctgcccggcgcccgcccctgcggcaccgtgctggaggcc
gccaagcgcgccggcttggccaccggcctggtcgtcaccaccgacgtcaccgacgccacg
cccgcctgcttcgccgcccacgtggactaccggctgcgccaggacgagatcgcgctgcag
gaggtcggcgagggcgtgctgggccggagcgtcgatctgatcctcggcggcgggaggtgt
catttcctggcgaatcacacccggggcagctgcagggcggatgatgtcgatgtggtgggg
attgcgcgcgagaagcacgggtgggtgtacaagagcgatcggaaggggtttgacgagctg
gcgatggggaggaacgtgagcctgccgctgctggggctgttcgcggcgtcggacgtgccg
ttcgagatcgaccggcagaatatggccgacgtgtatcccagcctgagcgagatgacggcg
acggcgttgacggcgctgcacgaggccaccaaggacagcgatcagggcttcttcctcatg
atcgagggaagccggatcgatcatgcgggccacatcaacgatcctgcggcgcaggtgagg
gaggtgctggagtacgataggacgttccagatcgtgctcgacttcctggagcagtcccag
acggagggtgtgttggtggccacgagtgaccacgagacgggcggcctagccaccgcttgg
caagcacccaacgaactgcccgtctacgactggtatccagccgtgctggccaaggccaac
gcctcggccgagtactgctcgctcctgctgcaacagcacctcgcctcgatctcttcatcc
tcctccgacggctcgccgccgtcgaagaagtccctcatcgactggatcaaccaggagctg
gtcgtccgccgcctcggcatcaccgacgcacgcgacgccgagctcgccgccctcgccgcc
aaacccgaggccgccacgcacatcttttcgcgcatggtcagcgtccgcgcccacgtcggc
tggagcacccacggccacagcgccatcgacgtgaatatctacagctccggcggccccggg
acggagaggctccgcgggaacgtggagaacacggaggtgggcaagttcttgagcgagtat
ctcggtgtggatgtcggtgagatcacgaaggagctggaggagaagttgaagggtagacca
gcgggcagagaggttgaggttcagcgggaggtggagactcgtgtgcatcctgaggaatgg
tttagggagatgggaatctaa

DBGET integrated database retrieval system