KEGG   Thielavia terrestris: THITE_2149004Help
Entry
THITE_2149004     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ttt  Thielavia terrestris
Brite
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     THITE_2149004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(4131890..4131900,4131972..4132306,4132403..4132476,4132565..4132617,4132721..4132772))
Genome map
AA seq 174 aa AA seqDB search
MGNTTSAVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDQDGKISFEEFTRMVENTDVSISMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgaccagcgcggtgctggacaacattgtccaggggtccaacttcgacagg
gaggaggtggacaggctacggaagaggttcatgaagttggacaaggacaactccggcaca
atcgagcgcgaagagttcctgagcctgccgcaaatatcgtcgaacccgctggccacgaga
atgatagcaatcttcgacgaggacggcggcggcgacgtggacttccaggagttcgtgtcc
gggctgagcgccttcagcagcaagggcaacaaggagcagaagctgcgcttcgccttcaag
gtctacgacatcgaccgcgacggctacatcagcaacggcgagctgttcatcgtgctcaag
atgatggtcggcagcaacctcaaggaccagcagctgcagcagatcgtcgacaagaccatc
atggaggccgacctcgaccaggacggcaagatcagcttcgaggagttcactaggatggtc
gagaacacggacgtgagcataagcatgacgctggatcagttctga

DBGET integrated database retrieval system