KEGG   Thielavia terrestris: THITE_2149193Help
Entry
THITE_2149193     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thielavia terrestris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(5632377..5632990,5633087..5633401,5633495..5633561,5633632..5633764,5633875..5633987))
Genome map
AA seq 413 aa AA seqDB search
MADLQGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKKSFPSLFPNANPDALDLLDRMLAFDPS
RRISVEAALEHPYLAIWHDASDEPDCPSTFNFDFEVIEDVNEMRKMILDEVFRFRQLVRT
APGATVHGAPGQPQAPAQVPMPAGGPSQQWTAEDPRPQEYGTMQGLEAELAGR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttacagggccgcaagattttcaaggtcttcaaccaggatttcattgtcgat
gagcggtacacggtgaccaaggagctgggccagggagcctatggcattgtctgcgcggcc
gtgaacaaccaaaccaacgagggcgtcgccatcaagaaggtcaccaatgtcttcagcaag
aagatcctggccaagcgcgccctgcgcgagatcaagctgctgcagcactttcggggccac
cgcaacatcacttgcctgtatgacatggacattcccaggcccgacaacttcaacgagacg
tatctctacgaagagctgatggaatgcgaccttgcggcgatcatccggtccggacagccg
ctcaccgacgcccacttccagtcgttcatctaccagatcctctgcggtctgaagtacatc
cactcggccaacgtgctgcaccgcgatctcaagccgggcaacctcctcgtcaacgccgac
tgcgagctgaagatctgcgatttcggcctcgcgcgcggcttctcgattgatcccgaggaa
aacgccgggtatatgaccgagtacgtcgcaacgagatggtaccgcgcgcccgagatcatg
ctcagcttccagaactacaccaaagctatcgacgtgtggtcggtcggatgcatccttgct
gagctgctcggcggccggcccttcttcaagggccgcgactacgtcgaccagctcaaccag
atcctgcacatcctgggcacgcccaacgaggagacgctctcacggatcgggtcgccgcgc
gcccaggagtacgtgcgcaacctgccgtacatggccaagaagtcgttcccctcgctgttc
cccaacgccaacccggacgcgctcgacctgcttgaccgcatgctcgccttcgacccctcg
cgccgcatctcggtcgaggccgccctcgagcacccctacctcgccatctggcacgacgcc
agcgacgagcccgactgcccgagcaccttcaacttcgacttcgaggtcatcgaggacgtc
aacgagatgcgcaagatgatcctcgacgaggtcttccgcttccgccagctcgtccgcacc
gcccccggcgccaccgtccacggcgctcccggccagccccaggcccccgcccaggtcccc
atgcccgccggcggcccgagccagcagtggaccgccgaggacccgcgcccccaggagtat
ggcaccatgcaggggctcgaggccgagctggcgggcagatga

DBGET integrated database retrieval system