KEGG   Thielavia terrestris: THITE_2149193Help
Entry
THITE_2149193     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ttt  Thielavia terrestris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    THITE_2149193
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     THITE_2149193
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   THITE_2149193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(5632377..5632990,5633087..5633401,5633495..5633561,5633632..5633764,5633875..5633987))
Genome map
AA seq 413 aa AA seqDB search
MADLQGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKKSFPSLFPNANPDALDLLDRMLAFDPS
RRISVEAALEHPYLAIWHDASDEPDCPSTFNFDFEVIEDVNEMRKMILDEVFRFRQLVRT
APGATVHGAPGQPQAPAQVPMPAGGPSQQWTAEDPRPQEYGTMQGLEAELAGR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttacagggccgcaagattttcaaggtcttcaaccaggatttcattgtcgat
gagcggtacacggtgaccaaggagctgggccagggagcctatggcattgtctgcgcggcc
gtgaacaaccaaaccaacgagggcgtcgccatcaagaaggtcaccaatgtcttcagcaag
aagatcctggccaagcgcgccctgcgcgagatcaagctgctgcagcactttcggggccac
cgcaacatcacttgcctgtatgacatggacattcccaggcccgacaacttcaacgagacg
tatctctacgaagagctgatggaatgcgaccttgcggcgatcatccggtccggacagccg
ctcaccgacgcccacttccagtcgttcatctaccagatcctctgcggtctgaagtacatc
cactcggccaacgtgctgcaccgcgatctcaagccgggcaacctcctcgtcaacgccgac
tgcgagctgaagatctgcgatttcggcctcgcgcgcggcttctcgattgatcccgaggaa
aacgccgggtatatgaccgagtacgtcgcaacgagatggtaccgcgcgcccgagatcatg
ctcagcttccagaactacaccaaagctatcgacgtgtggtcggtcggatgcatccttgct
gagctgctcggcggccggcccttcttcaagggccgcgactacgtcgaccagctcaaccag
atcctgcacatcctgggcacgcccaacgaggagacgctctcacggatcgggtcgccgcgc
gcccaggagtacgtgcgcaacctgccgtacatggccaagaagtcgttcccctcgctgttc
cccaacgccaacccggacgcgctcgacctgcttgaccgcatgctcgccttcgacccctcg
cgccgcatctcggtcgaggccgccctcgagcacccctacctcgccatctggcacgacgcc
agcgacgagcccgactgcccgagcaccttcaacttcgacttcgaggtcatcgaggacgtc
aacgagatgcgcaagatgatcctcgacgaggtcttccgcttccgccagctcgtccgcacc
gcccccggcgccaccgtccacggcgctcccggccagccccaggcccccgcccaggtcccc
atgcccgccggcggcccgagccagcagtggaccgccgaggacccgcgcccccaggagtat
ggcaccatgcaggggctcgaggccgagctggcgggcagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system