KEGG   Thielavia terrestris: THITE_2149883Help
Entry
THITE_2149883     CDS       T02228                                 

Definition
glycoside hydrolase family 11 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2159652..2160066,2160140..2160393))
Genome map
AA seq 222 aa AA seqDB search
MKVTAAFAGLLATALAAPAPKTDLMARGKTDLVERAAGINYVQNYNGNLGYFTYNEGAGQ
FSMYWQQGVSNDFVVGLGWTTGAARTITYQATYNAASSGSYLAVYGWVNSPQAEYYIVES
YGTYNPCSSGSATNLGTVSSDGGTYQVCTDTRYNQPSITGTSTFTQFFSVRQSKRTSGTV
TVGNHFNFWAQHGFGNSNFNYQVMAVEAWSGSGYATVTITSA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcactgcagctttcgcaggcctcttggccacggccctcgccgcccctgccccc
aaaaccgatctgatggcgcgaggcaaaactgatctggtggagcgagccgctggtatcaac
tacgtccagaactacaacggcaacctgggctacttcacctacaacgagggtgccggacag
ttttccatgtactggcagcagggagtcagcaacgatttcgtcgttggtttgggctggacc
actggtgccgccaggaccatcacctaccaggccacctacaacgccgcgagctctggctcc
tacctcgccgtgtacggctgggtcaactctccccaggccgagtactacatcgtcgagtcg
tacggcacgtacaacccgtgcagctcgggctccgccaccaacctcggcacggtgtcgtcc
gacggcggcacctaccaggtctgcaccgacacgcggtacaaccagccgtccatcacgggc
accagcacgttcacgcagttcttctccgtccgccagagcaagcgcacctccggcaccgtc
accgtcggcaaccacttcaacttctgggcccagcacggcttcggcaacagcaacttcaac
taccaggtcatggccgtggaggcttggagcggttccggctacgccaccgtcaccatcact
tctgcttag

DBGET integrated database retrieval system