KEGG   Thielavia terrestris: THITE_2151181Help
Entry
THITE_2151181     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THITE_2151181
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2151181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(894100..894968,895043..895793,895879..896230,896324..898727,898786..899447,900165..900220,900412..900415,900464..900477))
Genome map
AA seq 1703 aa AA seqDB search
MAAFRQELYSLSCKVFSQHPAFQQRQLAFTTSSQKKRRITRQSTREHGKPEDLLLPSTED
DADPTFSFSVASASGCSTPTFLRADSLPPSGVPPRLQSRGTPFADSPSSAASSPCAASAD
LSVDFDRSADFTDSGSALQLPDHHAPAGNQSPIHQCVRRAFMGSTADLPQRSSSPLKRRA
SSMEPEHNAADAREDVDMLRPPDSEAEPPAEPAVGPKEEDAQVVTAGGSNNAPLAGDKAE
LPLRNDIPPLDQQIKTIETLVKAFAETPAKEGDEAYLVSRRWLSKAQAFRSDAKHANKEA
SEGSLGPVDNSDIIQAIFTDSAGVLCVKLKPGMGVENFELFPKDAWDLLLSWYGLAPGQS
PIVRLAHNTAPDSVSIPTIQYEFHPPVFTIHRLWSATSPIPIEQEVKLKKPPPPVVVQST
SFGYNNFLKQVKALAGISPDRKVRVWRVLQTIPATESVAEPSGMKTPPDSPDRDPGILTQ
PPAIPGSWPEMLVDVESFLKLERDVERGLVEAEDTTTNPNYNGRKSLALVGLAVDQTLVL
DEQIERDAYVSTFRGSGIKDKAIASRGSSTSLAAQTRGNTSGRSSPAFQGPQTRGRSQHK
SGRTIGCVGLQNLGNTCYMNSALQCVRSVEELTKYFLTHEAHKEINPDNPLSHNGDVAAA
YGRLLEEIYKDPAPLSVAPRHFKGIIGRYAPAFSGYGQQDSQEFLGFLLDGLQEDLNRIK
KKPYIEKPDSTDDMINNPAAVREMAAKVWDITKKRDDSVIADLFTGMYKSTVVCPVCDKV
SITFDPFNNLTLPLPVANVWSRPVKYFPLNDAPVMIVVDLDKNSSIRALKQFIAARVGVP
PERLFAAEEFQAKFFKLYDDGAAVSEEIQPSDVPVVHELEAAPTNTAGRKRQTKKQRPRL
PSEEEDEDSSPVHDPRAERLLVPVLHRLDPQDPSSRKRYGRKMSEVVPPPHCIVLTPEEA
RDMEVIRRKILEKVATFTTWPLLADSEDGETAETTDPEMVNTASDVDSAGDSKVVAKSVE
GEDDMVDVTMRDAAEPRDPSVPAPPEESRSPQVLRRFKQRRPKWLDPRQFLDPELQNLFD
LSYFTESDTTLPTGFNSTSEDRELPRLSSRLPKPPASDVEMASPGPVDGSDESDNEESGN
VSAALLTRMAEESSEEDLEFSRPKNLPPRASGPAFQSHVSARGKKKLKAFKTYGKKGKQR
LNRQQRAARFQQSAAPAFDVEEDVLPPGGALIGLGEGIMVEWSDAALDLVFGGTSPGDMR
GLKTYKAPETLEDPALEARKKARQLRKKHGIALDDCLDEFEKEEILSEQDTWYCPRCKEH
RRASKKFDLWKTPDILVVHLKRFSSTGWRRDKLDILVDFPVEGLDLTRRVIDKEDGKQEV
YDLIAVDDHWGGLGGGHYTAFAKNFVDGQWYEYNDAQVSKLTDTSRVVSSAAYLLFYRRR
SEVPLGGPRFQEIFDRYNNPDEAMSDSGEGQRLGQGSSRRGSPSASTGAGPALPPNERGW
IRGQESERPSCPDDDTTLGGQLSWSNENTLHNSIEGDGEDEGIGLPDYDNAGMAGMTSVI
GPSNWSFGNLVNKADSDADADIASDVAQNDGSSVQEFDDVPVGGGDVEHLLPLEPGAEYI
EPLEPSGDGFADYDAPPPPPSVEDQNYMSRIAAETWVKQQIHTVPPMNTLNGEDDDRASD
RVAEIHVGGDAEDDDDGQDKPRA
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttcaggcaggaattgtactcgctaagctgcaaggtgttcagccagcatcca
gcctttcagcaacggcagctcgccttcaccacgtcttcccaaaagaaacggaggattacc
cgccagtcgaccagggagcacggcaagcctgaggacttgctgctgccctccaccgaagac
gacgccgatcccaccttctccttttcggttgcttccgcctccggctgcagcacacccacc
ttcctccgcgccgattcgctccctccctccggtgtccctccgcgcctgcagagccggggc
acgccctttgccgactccccatcctcagccgcgagctccccctgtgctgcgtcggcagac
ctgtccgtcgatttcgaccggtccgccgacttcaccgactccggctcggccctgcagctg
ccagatcaccacgcgccggcgggaaatcagtcaccaatccaccagtgtgttcgacgagcc
ttcatggggagcaccgcagatctcccccagcggtcctcatccccgctcaaacgcagggca
tccagcatggagccggagcacaacgccgcggacgcgagggaggatgtcgacatgcttagg
cccccggattctgaggcagaaccaccggcggagccggcagtggggccaaaggaggaggac
gctcaagtagtgacggccggcggttcaaacaacgctcccctggctggcgacaaagcagag
ctacccctacgaaacgatatccccccgctcgaccaacagatcaagaccatcgagacgctc
gtcaaggcttttgccgagaccccggcgaaggagggtgatgaggcatatctcgtgtctcgg
cggtggctcagtaaagctcaggcttttagatcggacgcgaagcatgccaacaaagaggcc
tcggaagggtcgctcggtccggtcgacaattcagacatcattcaggccatattcacagac
tcggcgggcgtgctctgcgtcaagttgaagcccggaatgggcgttgagaacttcgagctg
tttcccaaggatgcttgggatctcctcctatcttggtacggcttggcccctggtcagtcg
cctatcgtccgcctcgcccacaacaccgccccggactctgtgagcatcccgaccatccag
tacgagttccatcccccggtgtttacgatccaccggctatggtccgcgactagccccatt
ccgatcgagcaggaagtcaagctcaagaagcccccgcctcctgtcgttgtccagagcacc
tcgttcggctacaacaattttctgaagcaggtgaaggcgctcgccgggatatcaccggac
cgcaaggtgcgcgtgtggagagtcctccagaccattccggccaccgagtccgtcgcggag
ccgtccgggatgaagactccacccgactcgccggaccgtgaccctggcattctcacgcag
cccccggccattcccgggtcctggccggaaatgcttgtcgatgtggagtcgtttttgaag
ctcgagagggacgtcgaacgtggtctcgtggaggctgaggacaccaccacaaatcccaac
tataatgggagaaagagtcttgcgctggtaggccttgctgtcgatcagacgcttgttctg
gacgagcagattgagcgggatgcctatgtctcgacctttcggggcagtggcatcaaggat
aaggccatcgcgagccggggcagctcaacaagcctggcagctcagacccgtggcaatacc
agcggacgcagcagcccggcgtttcaggggcctcagacgaggggtcgctctcagcacaag
tcgggtcgtaccataggctgcgtcggcctgcagaacttgggcaacacctgctacatgaac
tcggctctccagtgtgtgaggagcgtcgaggagcttacaaaatatttcctcacgcacgag
gcccacaaagagatcaacccagacaacccactttctcacaacggtgacgtcgcggctgct
tatggacgtctgctggaggagatttacaaggacccggcgccgctctcggttgctccgcgt
catttcaagggcatcattgggcggtatgcgcccgcattctcggggtacggacagcaggat
tcacaagaattccttgggtttctcctggacggcctccaagaagatctgaaccgcatcaag
aagaagccctacattgagaagcccgactccaccgatgacatgatcaataacccggcggcc
gtccgcgagatggctgccaaagtgtgggatatcaccaagaagagggacgactcggtcatt
gccgatctcttcaccggcatgtacaagtccaccgtggtgtgccccgtctgcgacaaagtt
agcatcacgttcgaccccttcaacaacctcaccctgccgctccccgtggccaacgtttgg
tcccgtcctgtcaagtatttccctctgaacgatgcgcctgtcatgatcgtggtcgacctc
gacaagaacagcagtatcagggcgctgaagcagttcatcgctgcgcgggtgggagttccc
ccggagcgcctcttcgctgcagaagaatttcaggccaaattcttcaagttgtatgatgat
ggggctgcggtctctgaggagatccagccgagcgacgtccccgtggttcacgagcttgag
gccgctcccaccaatacagctggacgcaagagacagaccaagaagcaacggccaaggcta
ccgtccgaggaagaggatgaagattcttctccggtgcatgatcccagagcggaacgcctc
ctggtcccggtcctgcatcgtctcgatccccaggacccttctagccggaaacgctacggg
cgcaagatgtccgaggtggtccctccgccgcactgcatcgtcctgacgcctgaggaggct
cgtgacatggaagtcattcgccgcaagatcctggagaaggttgcgacctttacgacgtgg
cctctgcttgcggattccgaggacggcgaaacagccgagacgacagacccggagatggtc
aataccgcatcggacgtggattccgccggcgactccaaggtggtagctaagtccgtcgag
ggcgaggacgatatggtcgacgtcacaatgcgcgacgcagccgagccgcgggacccgtct
gtgcctgcgccgcctgaagaaagcaggtcgccacaggtgctgagacggttcaagcagcgg
cggcccaagtggcttgaccctcgccaattcctcgaccccgaattgcagaatctcttcgat
ttgagttactttactgagtcggacaccacccttccgactggcttcaattcgacttcggaa
gaccgcgagctacctcgactgagctccaggctgcctaagcctcccgcctcggacgtcgag
atggcaagtcccgggccggtggacggttccgatgagagcgacaacgaagagtcggggaac
gtctccgctgcgctcctcacccgtatggctgaggagtccagcgaagaggacctggaattc
tccagacccaagaacctgccccctcgagcatccgggccagcgttccagagtcacgtaagc
gcccggggaaaaaagaagttgaaggccttcaagacttacggtaaaaaggggaaacagcgc
ctcaacagacaacagcgagctgcccgtttccagcagtcagcggcgccggcgtttgatgtt
gaggaggatgtgcttcctcctggcggagccttgatcggccttggcgaaggcatcatggtg
gagtggagcgatgctgctcttgacttggtctttggcggcacatcgccgggtgacatgcgg
ggcctgaagacgtacaaggctcccgagacgcttgaggatcccgcgctggaagccaggaag
aaggcgcgacagctgcgaaagaagcacggcatcgcgttggacgactgcttggacgagttc
gaaaaggaggagatcttgtccgagcaggacacttggtattgtccgcgctgcaaggaacac
cggcgtgctagtaaaaagttcgatctctggaagacgccggacatcctcgtggtccacctt
aagcggttcagctccaccggctggcgtcgagacaaactggatattctggtcgatttcccc
gtcgaggggctcgatctgacgagacgggtcatcgacaaggaagacggaaagcaggaggtt
tacgacttgatcgccgttgacgaccattggggcggcctcgggggcggccactacacggcc
ttcgccaagaatttcgtcgatggccagtggtacgagtacaatgatgctcaggtgtcaaaa
ttgaccgatacctcgagggtcgtttcgtcggcagcctatctcctcttctatcgtcgccgg
tctgaggtgcccttgggcggtcccaggtttcaagagatctttgaccgctacaacaaccct
gacgaagccatgtcggactcgggggaaggtcagcgtctcggccaaggctcctcccgtcgt
ggatcgccgagcgcttcaaccggagcaggtccagctctcccgccaaatgaacgtggatgg
attagaggtcaggagtcggagcgaccgtcgtgcccggacgacgataccaccctgggtggt
cagctgtcgtggagcaatgagaacacgctccataacagcatcgagggcgatggcgaagat
gagggcatcggcctccccgactacgacaatgccggcatggccggcatgacctcggtcatc
ggaccgagcaactggagcttcggcaacctcgtcaacaaggcggactcggatgctgacgcc
gacatcgccagcgacgtggcgcagaacgatggttcgtcggttcaggaatttgacgatgtg
cccgttggcggcggggacgtggagcacctcctgccgctggagcccggggctgagtacatc
gagcctctcgagccatcaggggacggcttcgccgactacgacgccccgccgcctccgcca
tcggtcgaggaccagaactacatgagccggatcgccgccgagacctgggttaagcagcag
atccacacggtgccgccaatgaacacgctcaacggggaggacgacgaccgggcgagcgac
agggtcgcagagatccacgtcggcggcgacgcggaggacgacgacgatggccaggacaag
ccgcgcgcttag

DBGET integrated database retrieval system