KEGG   Thielavia terrestris: THITE_2151577Help
Entry
THITE_2151577     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     THITE_2151577
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   THITE_2151577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3732582..3733384,3733443..3734181,3734242..3734401,3734463..3734662,3734738..3735550))
Genome map
AA seq 904 aa AA seqDB search
MEQWQAYGDPASAGGQRRYNGNNVSVGVSQMAPRDYGTSTSSQPPAQQPPAGFKYDNYQG
GLNPHHTAASTSSPMGSPLMRDGSGDIPMQDSHDSYAGLNPTTGTYPLRPHHQHHLSGSR
TANLQQEPSAAAQRYSPMEALSPTSPYSSKTAGHFSQQPPAQRQSPTRSSDYATQQNSYY
SSRQTAPQLPPINPYSSGQDTYSPSSVSAVDGAYMDPKSPKRVPPQPTVQPTHDKGPVPE
FRRIRAPTDLKPKVNDQPPFRRANPEGGFISPLQALTVHLPATYRICNPNFKYESSRNPR
RVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVVKCQN
LKTQEVVAVKVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDDHHLLRLKDTFIHRQHLCLV
FELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKARLIHCDLKPENILLKNLE
SPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLP
LFPGSSEYNQVSRIVEMLGNPPNWMIEMGKQAGEFFEKRQDEYGRRTYHLKSIEQYSRER
GVKEQPSKKYFQANTLPEIIKSYPMPRKNMKQAEIDREMNNRIAFIDFVRGLLTINPLER
WSPQQAKLHPFITQQKYTGQFVPPMNLRSSALNRSPAPGTQQQLQAEAMSKQRAQAAQAQ
AQASTAAQGAYGPMVSGQYAQQGHPQQPPLYGNNNMYSPGGAHTGPPPPYGGQQGGYSHS
QMGMSQGPVQMPPANYSQSGMYGQPNRSRQRASTMEQQQSGIPASIQRVASHLDPTQPIR
LQPSPAYFPPPAEAFTGMDHQTPGRAVRRGSRAQQPGRSRDFIRNLEERTLEEGFMGSGQ
SPWQ
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatggcaggcgtacggcgaccctgccagtgctggcggccagcgacggtacaat
ggaaataacgtgagcgtcggcgtcagccagatggccccgcgagactatggcaccagcacc
agcagccagccccccgcgcagcagcccccggctggcttcaagtacgacaactaccagggc
ggcctcaacccgcaccacaccgcagcgtcgacgtcgtcgcccatggggagcccactgatg
cgcgacggaagcggcgacatcccgatgcaggactcgcacgattcgtacgccggcctcaat
cccaccaccggcacctacccgctgcggccccatcatcaacatcatctctcgggcagccga
accgccaacctccagcaggagccctctgccgccgcccagcgatactcacccatggaggcc
ctatcgcccacctcgccctacagctccaagacggccggccacttctcgcagcagccgccc
gcgcaacggcagtcgccgacgcggtcgtcggactacgccacgcagcagaactcatactac
agcagccgacagacggccccacagctgccgcccatcaacccttacagctccggacaggac
acgtactcgccgtcgtccgtgagcgccgtggacggcgcctacatggacccgaagtcgccc
aaacgtgtcccgccccaaccaaccgtgcaaccgacacacgacaaggggcccgtgcccgag
ttcaggagaatccgggcgccgacggacttgaaaccgaaggtcaacgaccagccgcccttt
cggcgagccaatcctgaaggtggcttcatcagccccctccaagcgctcacggtgcatctc
ccggcgacttaccgcatttgcaatccgaatttcaaatacgagtcgtcgcgtaacccccgc
cgcgtcttgactaaacccagcaagggcgtgaagaacgacgggtatgacaacgaggatagc
gattacattctctacgtcaacgacattctgggctccgaggaggccgggcacaagaaccgg
tatctaatcctcgacgtcctcggtcaaggtaccttcggccaagtggtgaagtgccagaat
ctgaaaacgcaggaggtggtagcggtcaaggtgatcaagaaccgcaccgcatatttcaac
cagagtatgatggaggtgtctgttttggacttgctcaacaccaagctggacaagaatgac
gaccaccatctcctacggctcaaggacaccttcatccacaggcaacatctgtgcttggtt
ttcgagctgctcagtgtgaacctgtacgagctcatcaaacagaaccagttccgcggcctc
agcaccacgcttgttcgcgtttttgctcaacagctcctcaatggtctggcgctgctgaac
aaggcgaggctgatccactgcgatctgaaacccgagaacatcctgctcaagaacctcgag
agccccatcatcaagatcatcgatttcgggtctgcgtgcgacgaacggcagaccgtctac
acgtacatccagtcgaggttctaccggtcgcccgaagtattgctcggcctgccctactcc
tcagccatcgatatgtggtcgctgggctgcatcgtggtcgagttgtttctcggtctcccc
ctgtttccgggatcttccgagtacaaccaggtctcgaggatcgtcgagatgctcggcaat
ccgccaaattggatgattgagatgggcaagcaagctggcgagtttttcgagaagaggcag
gatgagtacgggaggcggacgtaccatctgaagagtatcgagcagtactcgcgagagcgc
ggcgtgaaggaacagccgagcaagaagtacttccaggccaacacgttaccggagatcatc
aagtcataccccatgccccgcaagaacatgaagcaggccgagattgatagagagatgaac
aatcgcatcgcgtttatcgacttcgtcagaggtctgctgactatcaaccctctcgagaga
tggtcgccgcagcaggctaagctgcatcccttcatcacgcagcagaagtacacgggccag
ttcgtgccgccgatgaacctcaggtcgagcgcgctgaaccggtcgccggccccgggcacg
caacagcaattacaggccgaagccatgagcaagcagagggcgcaagccgcacaggcccag
gcccaggctagcacagcggcccaaggggcttatggccccatggtcagcggacaatatgcg
cagcagggtcacccgcaacaaccgccgctttacgggaacaacaacatgtactcgcccggt
ggggcgcatacaggaccgccgcctccgtatggtggccagcagggcggatacagccacagc
cagatgggcatgtcgcaggggcccgtgcagatgccgcctgccaactactcccagtccggc
atgtacgggcagccaaaccggtccaggcagcgcgcctcgacaatggaacagcagcagagc
gggatcccggcatcgatccagagggtagccagccatctcgacccgacccagcctatccgg
cttcagcccagccccgcctacttcccgcctcccgctgaggcttttacgggcatggaccac
cagacgccagggagagccgtgaggagaggaagccgcgcgcagcagcctggccgcagccgc
gactttatccgcaacctggaggagcggacactagaggaagggttcatgggcagcggccaa
agcccgtggcagtga

DBGET integrated database retrieval system