KEGG   Thielavia terrestris: THITE_2169483Help
Entry
THITE_2169483     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2169483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(5293828..5294091,5294162..5294613,5294690..5295047)
Genome map
AA seq 357 aa AA seqDB search
MAGLFGTATSTTSNTLGDLKQDVELGSPPEDSISDLAFNPNPADLKDFLAVASWDKKVRI
YEIMSNGQGQGKAQIEHDGPVFSVDFFKDGQKVISGGADKQAKVLDLATGQMLQVAQHDQ
PVRSVRYFESNGTPMAVTGSWDKTIKYWDFRTPQPAGTVTCQERVYTMDVRENLLVIGTA
DRYINVINLKEPVKFYKTLQSPLKWQTRVVSCFTDSQGFAIGSIEGRCAIQYVEDKDSSL
NFSFKCHRDPPQGNVTNVYAVNDISFHPQHGTFSTAGSDGTFHFWDKDAKHRLKGYPNVG
GSITATTFNKTGSIFAYSISYDWSKGFQGNTPSYPTKVMLHPVQQDECKPRPSAKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctttttgggacggcgacgtcgacgacttccaacacgctcggcgacctgaag
caggatgttgagctcgggagcccgcccgaagatagcatctcggacctcgcgttcaatccg
aacccggccgacctcaaggacttcttggcggtggcgagctgggacaagaaagtgcgcatc
tacgagatcatgagcaatggccaaggccaagggaaggcccagatcgagcacgacggcccc
gtgttctcggtcgacttcttcaaggatggccaaaaggtgatctcgggcggcgccgacaag
caagccaaggtgctggacctcgccaccggccagatgctgcaggtcgcgcagcacgaccaa
cccgtgcgcagcgtgcgctactttgagagcaacggcacgccgatggccgtcaccggctcg
tgggacaagacgatcaagtactgggatttccgcactccgcagccagcgggcacggtgacc
tgccaggagcgcgtctatacgatggacgtgcgggagaacctgctcgttattggcacggcc
gaccggtacatcaacgtgatcaacctgaaggagccggtgaagttctacaagacgctgcag
agcccgctcaagtggcagacgcgggtagtcagctgcttcaccgactcgcaaggcttcgcg
attggcagcatcgagggccggtgcgcgatccaatatgtcgaggataaagactcgagcctg
aacttctccttcaaatgccaccgcgacccgccgcaagggaacgtgaccaacgtgtacgcg
gtcaacgacatctcgttccacccgcagcacggcaccttcagcacggcgggcagcgacggc
acgttccacttctgggacaaggacgccaagcaccggctgaaggggtacccgaacgtcggc
ggcagcatcacggccacgacgttcaacaagacgggcagcatcttcgcctacagcatcagc
tacgactggtccaagggcttccagggcaacacgccctcgtacccgaccaaggtgatgctg
caccccgtgcagcaggacgagtgcaagccgcggccgagcgccaagaaaaggtaa

DBGET integrated database retrieval system