KEGG   Thielavia terrestris: THITE_2170037Help
Entry
THITE_2170037     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K11227  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ttt  Thielavia terrestris
Pathway
ttt04011  MAPK signaling pathway - yeast
ttt04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    THITE_2170037
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    THITE_2170037
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     THITE_2170037
Protein kinases [BR:ttt01001]
 Serine/threonine kinases: STE group
  STE7 family
   THITE_2170037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Phostensin_N Seadorna_VP7 Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 11517763
NCBI-ProteinID: XP_003651962
JGI: Thite2_2170037
UniProt: G2R0G1
Position
2:join(2837670..2839265,2839350..2839775)
Genome map
AA seq 673 aa AA seqDB search
MSGHADSSDPVTPADEVLPTSNPASPGSVDDSSQASTPLDPPSASSDAAPSFSPAGELPR
RIPSLRTVSDPDHSSHMSPSSSVSGLLSTVRRPTPSAAGLPSDIMQRARALQEQRMNMGA
RTSGSPAGMNMNMNTNTNRGAPVGGGLAGGVAPNLRLPAGLTRPMHPGFPKSSPAVPGTR
KPPSLSERRAMKLGNLSGTGTPSPVGTPKLPDLGADAAQPPALNGEGRGSKLSDFKNYID
ADKGWITFEGAATITQTGVNFANGQTFSISLDEIEVLDELGKGNYGTVYKVRHARPKVPR
FGHGLSKVKASAATETENTSEDPSPSSTGSSGRATSGVVMAMKEIRLELDEAKFTTILKE
LVILHECVSPYIIDFYGAFYQEGAVYMCIEYMDGGSIDKLYAGGIPENVLRKITFATVMG
LKTLKDDHNIIHRDVKPTNILVNTSGQVKICDFGVSGNLVASIAKTNIGCQSYMAPERIS
GGALAAGAAGAADGTYNVQSDIWSLGLTIIECAMGRYPYPPEVSSTIFSQLSAIVEGDPP
DLPAEGYSPQARDFVRSCLNKNPKKRHTYAMLLAHPWIKSLGKPETIAEDAEAEAAAADD
ELADAAGQLSLSNPSGLVGEGDYEVAAWVRGVLERKRAAGGRLPMEEDPPRRPALHAAPL
DSVSPVSSPMLGH
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccacgccgacagctccgacccggtcacgccggccgatgaggtcctccccacg
agcaaccctgcctcgccgggctccgtcgacgactcctcccaggccagcacgccgctcgac
ccgccgagtgcgagctccgatgcggcacccagtttctcccccgccggcgagcttccccgc
cggatcccctccttgagaacagtgtcagaccccgaccactccagccatatgagcccgagt
tccagcgttagcgggctgttgagcacggtcaggagaccgacgcccagcgcggctggcctg
ccgtcagatatcatgcagagggcacgagccttgcaggaacagcgcatgaacatgggcgcc
cgcacatccggctcgcccgctggcatgaacatgaacatgaacacgaacacgaacagggga
gcgcccgtcggcggcgggctagcaggcggcgtggcgccgaacctcaggttaccagccggc
ttaacacgccccatgcaccccgggtttcccaagtcgtcccccgccgtcccaggcacaagg
aaacctccaagcctgagcgagaggagagccatgaagcttggcaacctatcaggaacagga
actccctcgcctgtgggcacgccgaaactgccagatcttggcgccgacgcagcacagccg
ccagcgctgaacggcgaagggcgcggttccaagctcagcgactttaagaactatattgac
gcagacaagggctggatcacgttcgagggagctgcgaccatcacgcagacgggggtcaac
ttcgccaacggccagactttctccatctccttagacgagatcgaagtgctcgacgagctc
ggcaagggcaactacgggaccgtctacaaggtcaggcacgcgcggcccaaagtgccgcgg
tttggccacgggttgagcaaggttaaggcatcggccgcgaccgaaacggagaataccagc
gaggacccatcaccaagctcgaccgggagcagcgggcgggcgacttccggggttgtcatg
gccatgaaagagatccggctcgagctcgacgaggccaagttcaccacgatcctaaaggag
ctcgtcatcctccacgagtgcgtttccccgtatatcatcgacttttatggcgccttctac
caggagggcgccgtctacatgtgcatcgagtacatggacggcggcagcatcgacaagctg
tacgccggcggcatcccggagaatgtcctgcgcaagatcaccttcgccaccgtcatgggc
ctcaagacgctcaaggacgaccacaacatcatccaccgcgacgtcaagccgaccaacatc
ctagtcaacaccagcggacaggtcaagatctgcgactttggcgtgtcgggcaacttggtg
gccagcatcgccaagaccaacatcggctgccagagctatatggcgcccgagcgcatcagc
ggcggcgcgctggccgcgggcgccgcgggtgccgccgacgggacgtacaacgtgcagagc
gacatctggagcttgggtctgaccatcatcgagtgcgccatggggaggtatccgtacccg
cccgaagtgtcgagcaccatcttcagccagctcagcgccatcgtagaaggcgacccgccg
gacctgccggcagagggctactcgccgcaggcgcgcgactttgtccgctcgtgcctcaac
aagaaccccaagaagcggcacacgtacgcgatgctgctcgcgcacccgtggatcaagagc
ctgggcaagcccgagacgatcgcggaggatgccgaggccgaggcggcggcggccgacgac
gagctcgccgacgcggccggccagctgagcctcagcaacccgtcgggcctcgtcggcgag
ggcgactacgaggtcgccgcctgggtgcgcggcgtgctcgagcgcaagagggccgccggc
ggccggctgcccatggaggaggacccgcccaggaggccggccctgcatgccgccccgctc
gactcggtcagtccggtctcgagtccgatgcttgggcattga

DBGET integrated database retrieval system