KEGG   Thielavia terrestris: THITE_2170481Help
Entry
THITE_2170481     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2170481
Translation factors [BR:ttt03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    THITE_2170481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(8349286..8349310,8349500..8349594,8349670..8350373,8350440..8350455)
Genome map
AA seq 279 aa AA seqDB search
MPGPAKRWEEEEESSSSAPDSPVVAPARRRFDDEEAEGSDVLESWDAAEDSEVEREKAKK
AAEAKAKAEAEAAANKKSRSQRIAERQAERAKAKAEAEAEESEEETEAQRRERLRRTEKE
SDLRHAEDLFADINIGSGRKATTAGSAVPIDASDPTKTIDLSSLPLFKPATKLQFEQLRN
VLVPLITSSSKKPHYTLFLQEFAKQLAKDLPSDQIKKVASTLTTLSNEKMKEEKAAEKGG
KKTKAAKTKASLAGVTRGGVTDLNTYEDDDDAFGDDDFM
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaccagcgaaacggtgggaggaagaagaggagtcctccagctccgccccggac
tctcccgtcgttgcacccgcgcgccgcagattcgacgacgaggaagccgagggcagcgat
gtgctagagtcgtgggacgccgccgaggactccgaggtcgagcgggaaaaggcaaagaag
gctgccgaagcgaaggcgaaggcggaggctgaagccgccgccaacaagaagagtagatca
cagcggatcgccgagcgccaggccgagcgtgcgaaggctaaggccgaagccgaggctgag
gagagtgaagaggagactgaggcccagcggcgcgaacgccttcgtcgcaccgagaaggag
tctgatctccgccacgccgaggacctgttcgcagacatcaatatcggcagcgggcgcaag
gccacgactgccgggtccgctgtgccgatcgatgcgagcgaccccaccaagaccatcgac
ctgtcctccctgccgctgttcaagcccgcgaccaagctgcagttcgagcagctgcgcaac
gtactagtcccgctcatcaccagcagctccaagaagccgcactacaccctcttcctccag
gagttcgccaagcagctggcgaaggatctcccgagcgaccagatcaagaaggtcgccagc
acgctgacgacgctcagcaacgagaagatgaaggaggagaaggcggccgaaaagggcggc
aagaaaacaaaggctgccaagaccaaggcttcacttgccggggtcacccgcgggggcgtg
acggacctaaacacgtacgaggatgacgacgacgccttcggagatgacgacttcatgtga

DBGET integrated database retrieval system