KEGG   Thielavia terrestris: THITE_2171067Help
Entry
THITE_2171067     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ttt  Thielavia terrestris
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THITE_2171067
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    THITE_2171067
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     THITE_2171067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(3662557..3662693,3662757..3663403,3663496..3663623)
Genome map
AA seq 303 aa AA seqDB search
MPALASARYGKDNVRVFKVHRDEQTGVQSVTEMTVCCLLEGEIETAYTKADNSVIVATDS
IKNTIYIKAKEHPVNPPELYASHLGQHFLDRYPHISAAHIRVVVHRWTRMTVDGAPHPHS
FFRDGQETRNVEATVARGTGITLESSIAGLPVLKSTGSAFHGFVRDEFTTLAETWDRILS
TDVDCAWTWRRFPTVAAVQDGVERFDKAWESARGIVMKTFATDESASVQNTMYKMCEQIL
EAVPEVDKVAFSLPNKHYFEIDLSWHKGTKNTGKDAEVYAPQSGPNGLIKCEVARDVSTV
ALR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctcttgcttctgcccgttacggcaaggacaatgtccgcgtgttcaaggtccat
agagatgagcaaacgggggtccagtccgtcacggagatgaccgtctgctgcctactcgag
ggcgagatcgagactgcctacaccaaggcagacaacagcgtcatcgtggccacggactcc
atcaagaacaccatctacatcaaggccaaggagcacccggtcaacccgccggagctctac
gccagccacctgggccagcacttcctggaccggtacccgcacatcagcgcggcgcacatc
cgcgtggtcgtgcaccggtggacgcgcatgacggtcgacggcgcgccgcacccgcacagc
ttcttccgggacggccaggagacgcgcaacgtggaggcgacggtggcccgcgggacgggc
atcacgctcgagagcagcatcgccggcctgccggtgctcaaaagcaccggctcggccttc
cacggcttcgtgcgcgacgagttcaccaccctggccgagacgtgggaccgcatcctgtcg
accgacgtcgactgcgcctggacctggagacgcttccccaccgtggcggccgtgcaggac
ggcgtcgagcggttcgacaaggcgtgggagagcgcccgcggcatcgtcatgaagaccttc
gccaccgacgagagcgcctcggtgcagaacaccatgtacaagatgtgcgagcagatcctc
gaggccgtgcccgaggtcgacaaggtggccttctcgctgccgaacaagcactactttgag
attgatctgagctggcacaagggtaccaagaacacgggcaaggatgccgaggtgtatgcg
ccgcagtcgggaccgaacgggctcatcaagtgcgaagtcgctcgggacgtttcgactgtt
gccctgaggtaa

DBGET integrated database retrieval system