KEGG   Thielavia terrestris: THITE_2171300Help
Entry
THITE_2171300     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     THITE_2171300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: peroxidase
Motif
Other DBs
NCBI-GeneID: 11522794
NCBI-ProteinID: XP_003656685
JGI: Thite2_2171300
UniProt: G2RF66
Position
5:join(1999815..2000301,2000395..2000768,2000848..2001060)
Genome map
AA seq 357 aa AA seqDB search
MATATRTFTRALRTSARPAFAAAPRVAFRQSGRRFYSSEPPAKQGSSTWLWLAGAAAVGG
GGAWFYLNNQQSSATPKAFTPKFEDYQAVYNEIANRLEEKDDYDDGSYGPVLLRLAWHAS
GTYDKETGTGGSNGATMRFSPESDHGANAGLKVARDFLEPVKAKFPWITYSDLWILAGVC
AIQEMLGPKIPYRPGRQDKDVSACTPDGRLPDGAQGQDHLRNIFYRMGFNDQEIVALSGA
HALGRCHPDRSGFSGPWTFSPTVLTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMMLP
ADMALVQDKKFKEWVQKYAADNDLFFRDFAAVIVKLFELGVPFKEDQERWVFKTVNA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcaacccgcaccttcactcgcgccctgcgcacctcggcccggcccgcgttc
gctgccgccccccgtgtcgctttccgccagagcggccgccgcttctattcgtcggagccg
cccgccaagcaggggtcgtcgacctggctgtggctcgccggtgcggctgccgtcggcggc
ggcggtgcctggttctacctgaacaaccagcagagctcggccacgcccaaggccttcacg
cccaagttcgaggactaccaggccgtgtacaacgagatcgccaaccgcctcgaggagaag
gacgactatgacgacggcagctacggcccggtgctgctccgcctcgcctggcacgccagc
ggcacctatgacaaggagacgggcacgggcggcagcaacggcgccaccatgcgcttctct
cccgagagcgaccacggtgccaacgccggtctgaaggttgcgcgcgacttcctcgagcct
gtgaaagccaagttcccctggatcacgtactccgatctctggatcctcgccggcgtctgc
gccatccaggagatgcttggccccaagattccctaccgtcccggccgccaggacaaggac
gtctccgcctgcactcccgatggccgcctgcccgacggcgcgcagggccaggaccacctc
cgcaacatcttctaccgcatgggattcaacgaccaggagatcgtcgcgctgtccggtgct
cacgcgctcgggcgctgccaccccgaccggtccggcttctccggcccctggaccttctcc
ccgactgtcctgaccaacgactactacaagctgctgctcgacgagaagtggcagtggaag
aagtggaacgggcctaagcagtacgaggacaagaagaccaagtccctgatgatgctgccg
gccgacatggcgctcgtccaggacaagaagttcaaggagtgggtgcagaagtacgcggcc
gacaacgacctcttcttccgggacttcgcggccgtgatcgtcaagctgtttgagctcggc
gtgccgttcaaggaggaccaggagaggtgggtgttcaagaccgtcaacgcctaa

DBGET integrated database retrieval system