KEGG   Thielavia terrestris: THITE_2171621Help
Entry
THITE_2171621     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ttt01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttt00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ttt00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ttt00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1887089..1888089,1888160..1888220))
Genome map
AA seq 353 aa AA seqDB search
MANFEIPSEQWAQVVEKPGGPVVYKKIPVQKPGPDEVLINVKYSGVCHTDLHAMMGDWPL
PPKLPLVGGHEGAGVVVAKGELVQDLELGDHAGIKWLNGSCLACSFCMQADEPLCPRALL
SGYTVDGSFQQYAIAKAAHVARIPKECDLEAVAPVLCAGITVYKGLKESGARPGQTVAIV
GAGGGLGSMAIQYARAMGLRVIAIDGGREKGESCRQLGAAAYVDFTSSSDLVQEVKQATP
EGLGPHAVLLLAVAEKPFHQATEYVRSRGTVVCIGLPAGAYLRAPVFDTVIRMINIKGSY
VGNRQDTQEALDFFQRGLIKVPYKTVGLSELQNVYQLMKEGKVIGRYVVDTSR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcgagatcccaagcgagcaatgggctcaggtggttgagaagccgggtggc
cccgtcgtctacaagaagatccccgtgcagaagcccggcccggatgaggtgctcatcaac
gtcaagtactcgggcgtgtgccacacggatctgcacgccatgatgggcgactggccgctg
ccgcccaagctgccgctcgtcggcggccacgagggcgccggcgtggtggtggccaagggc
gagctggtgcaggacctcgagctcggcgaccacgccggcatcaagtggctcaacggcagc
tgccttgcctgctccttctgcatgcaggcggacgagccgctgtgcccgcgcgcgctgctg
tccggctacaccgtcgacggcagcttccagcagtacgccatcgccaaggccgcccacgtg
gcccgcatccccaaggagtgcgacctcgaggcggtcgcgcccgtcctgtgcgccggcatc
accgtgtacaagggcctgaaggagtcgggcgcgcgcccgggccagaccgtcgccatcgtc
ggcgccggcggcggcctgggcagcatggccatccagtacgcgcgcgccatgggcctgcgc
gtgatcgccatcgacggcgggcgcgagaagggcgagagctgccggcagctcggcgcggcg
gcgtacgtcgacttcaccagcagcagcgacctcgtgcaggaggtcaagcaggcgacgccc
gaggggctgggcccgcacgcggtgctgctgctggccgtggcggagaagccgttccaccag
gcgaccgagtacgtgcgcagccggggcaccgtggtctgcatcggcctccccgcgggcgcg
tacctgcgcgcgcccgtgttcgacacggtcatccgcatgatcaacatcaagggcagctac
gtcggcaaccgccaggacacgcaggaggcgctcgacttcttccagcgcgggctcatcaag
gtgccctacaagacggtcggcctcagcgagctgcagaacgtgtaccagctgatgaaggag
ggcaaggtcatcggccgctatgtggttgataccagccggtga

DBGET integrated database retrieval system