KEGG   Thielavia terrestris: THITE_2171621Help
Entry
THITE_2171621     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt00071  Fatty acid degradation
ttt00350  Tyrosine metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2171621
  Lipid metabolism
   00071 Fatty acid degradation
    THITE_2171621
  Amino acid metabolism
   00350 Tyrosine metabolism
    THITE_2171621
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     THITE_2171621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Glucokinase
Motif
Other DBs
NCBI-GeneID: 11521831
NCBI-ProteinID: XP_003657837
JGI: Thite2_2171621
UniProt: G2RI39
Position
6:complement(join(1887089..1888089,1888160..1888220))
Genome map
AA seq 353 aa AA seqDB search
MANFEIPSEQWAQVVEKPGGPVVYKKIPVQKPGPDEVLINVKYSGVCHTDLHAMMGDWPL
PPKLPLVGGHEGAGVVVAKGELVQDLELGDHAGIKWLNGSCLACSFCMQADEPLCPRALL
SGYTVDGSFQQYAIAKAAHVARIPKECDLEAVAPVLCAGITVYKGLKESGARPGQTVAIV
GAGGGLGSMAIQYARAMGLRVIAIDGGREKGESCRQLGAAAYVDFTSSSDLVQEVKQATP
EGLGPHAVLLLAVAEKPFHQATEYVRSRGTVVCIGLPAGAYLRAPVFDTVIRMINIKGSY
VGNRQDTQEALDFFQRGLIKVPYKTVGLSELQNVYQLMKEGKVIGRYVVDTSR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcgagatcccaagcgagcaatgggctcaggtggttgagaagccgggtggc
cccgtcgtctacaagaagatccccgtgcagaagcccggcccggatgaggtgctcatcaac
gtcaagtactcgggcgtgtgccacacggatctgcacgccatgatgggcgactggccgctg
ccgcccaagctgccgctcgtcggcggccacgagggcgccggcgtggtggtggccaagggc
gagctggtgcaggacctcgagctcggcgaccacgccggcatcaagtggctcaacggcagc
tgccttgcctgctccttctgcatgcaggcggacgagccgctgtgcccgcgcgcgctgctg
tccggctacaccgtcgacggcagcttccagcagtacgccatcgccaaggccgcccacgtg
gcccgcatccccaaggagtgcgacctcgaggcggtcgcgcccgtcctgtgcgccggcatc
accgtgtacaagggcctgaaggagtcgggcgcgcgcccgggccagaccgtcgccatcgtc
ggcgccggcggcggcctgggcagcatggccatccagtacgcgcgcgccatgggcctgcgc
gtgatcgccatcgacggcgggcgcgagaagggcgagagctgccggcagctcggcgcggcg
gcgtacgtcgacttcaccagcagcagcgacctcgtgcaggaggtcaagcaggcgacgccc
gaggggctgggcccgcacgcggtgctgctgctggccgtggcggagaagccgttccaccag
gcgaccgagtacgtgcgcagccggggcaccgtggtctgcatcggcctccccgcgggcgcg
tacctgcgcgcgcccgtgttcgacacggtcatccgcatgatcaacatcaagggcagctac
gtcggcaaccgccaggacacgcaggaggcgctcgacttcttccagcgcgggctcatcaag
gtgccctacaagacggtcggcctcagcgagctgcagaacgtgtaccagctgatgaaggag
ggcaaggtcatcggccgctatgtggttgataccagccggtga

DBGET integrated database retrieval system