KEGG   Thielavia terrestris: THITE_34437Help
Entry
THITE_34437       CDS       T02228                                 

Definition
carbohydrate esterase family 8 protein (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ttt  Thielavia terrestris
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THITE_34437
   00500 Starch and sucrose metabolism
    THITE_34437
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     THITE_34437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(5200678..5201682)
Genome map
AA seq 334 aa AA seqDB search
MVSSLALLLPLVISAAAAPLETRAARTSPPTGCLAVGGSAQYKTVQSAVNALSTSSTTAQ
CIFIYAGTYNEQVLIPQLKSSLTLYGQTADTSSYSSNTVTITNGLSQDDGLTNDETATLR
AHTTNLKVYNINLVNTRGQGSQALALSAYADKQGYYGCQFKGFQDTVLAETGVQVYAKSY
IEGATDFIFGQYAQAWFDGVDIRVLAASVGYITANGRDSSTNPSYYVINKSTVAAKTGAT
VKDGAYYLGRPWRDYARVVFQETSLSSVINPAGWSIWSTSSPQTDHVTFAEYGNSGDGAK
GTRASFATKLSAPVSISTVLGSDYQSWVDTSYLS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttccctggcgctccttcttccgcttgtcatctcggcggccgcagcgccgctt
gagacccgcgctgcacgcacttcgccgcccacgggatgcctcgctgtcggcggctcggcc
cagtacaagacggtccagtcggcggtcaacgctctcagcacgtctagcaccacggctcag
tgcatcttcatctatgcgggcacctacaacgagcaagtcctcattccgcagctcaagtct
tccctgaccctctacggccagacggccgacacaagcagctactcgtccaacacggtcacc
atcaccaatggcctcagtcaggacgacgggctcacaaacgatgagaccgcgaccctccgg
gcgcatacgaccaacctgaaggtgtacaacatcaaccttgtcaacacgcgcggacagggc
tcgcaggcgctggccctcagcgcctatgcggacaagcagggctactacggctgccagttc
aagggtttccaggacaccgtcctggcggagacgggcgtgcaggtgtacgccaagagctat
atcgagggtgccaccgacttcatcttcgggcagtacgcccaggcgtggttcgacggcgtc
gacatccgcgtgctggccgcctcggtcggctacatcacggcgaacgggcgcgactcgtcc
accaatccgtcctactacgtgatcaacaagtcgaccgtcgcggccaagaccggcgccacc
gtcaaggacggcgcctactacctcggccggccctggcgcgactacgcccgcgtcgtcttc
caggagaccagtctgtccagcgtgatcaacccggccggctggagcatctggagcacgagc
agcccgcagaccgaccacgtcacgttcgccgagtacggcaactcgggcgacggcgccaag
ggcacgcgcgccagcttcgccaccaagttgtccgcacccgtgagcatctcgacggtgctg
ggcagcgactaccagtcctgggtcgacacctcctacctttcttga

DBGET integrated database retrieval system