KEGG   Thielavia terrestris: THITE_48486Help
Entry
THITE_48486       CDS       T02228                                 

Definition
glycoside hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(9395974..9396420,9396486..9396926,9396999..9397094)
Genome map
AA seq 327 aa AA seqDB search
MKAGLMLLLAPLAVSAAPALDSRQASQSIDKLFKAKGKHYFGTCTDQGRLQAGKNAAIID
ADFGQVTPENSMKWESIHPQQNTYSWGQADYLVNWATQHNKTIRGHTFVWHSQLAGWVQN
IRDKNTLTKTLQDHITTVMTRYKGKIYGYDVCNEIFNEDGSLRSSIWSQVLGEDVVSIAF
NAARAADPNAKLYINDYNLDSPSAAKLTNGMVAHVKKWLAANIPIDGIGTQGHITSGQGS
GLAGAIKALAASGVGEVAVTELDIQGNNANDYTAVTKGCLDEPKCIGITVWGVRDPDSWR
PQGNPLLFDSNYQPKAAYNAIVQLLSQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccggtctcatgcttctgttggcgccgctcgccgtctcggcagcgccggcgctg
gacagccgccaggcttcgcagagcatcgacaagctgttcaaggccaagggcaagcactac
ttcggcacctgcaccgaccagggccgcctccaggcgggcaagaacgcggccattatcgat
gccgacttcggccaggtgacgcccgagaacagcatgaagtgggagagcatccacccgcag
cagaacacgtacagctggggccaggccgactacctcgtcaactgggccacccagcacaac
aagaccatccgcggccacacctttgtctggcactcgcagctcgccggctgggtccagaac
atcagggacaagaacaccttgaccaagacgctgcaggaccacatcacgaccgtcatgacg
cgctacaagggcaagatctacggatacgacgtgtgcaacgagatcttcaacgaggacggc
agcctgcgcagcagcatctggtcgcaagtgctgggcgaggacgtggtcagcatcgcgttc
aacgcggcgcgcgcggccgacccgaacgccaagctgtacatcaacgactacaacctggac
agcccgagcgcggccaagctgaccaacggcatggtggcgcacgtcaagaagtggctggcg
gccaacatccccatcgacggcatcggcacgcagggccacatcaccagcggccagggcagc
ggcctggccggcgccatcaaggcgctcgccgcctcgggcgtcggcgaggtcgccgtcacc
gagctggacatccagggcaacaacgccaacgactacaccgccgtcaccaagggctgcctc
gacgagcccaagtgcatcggcatcaccgtctggggcgtccgtgatccggactcgtggcgg
ccgcagggtaacccgctgctcttcgacagcaactaccagcccaaggctgcctacaacgcc
attgtccagctgctgtctcagtaa

DBGET integrated database retrieval system