KEGG   Thielavia terrestris: THITE_72629Help
Entry
THITE_72629       CDS       T02228                                 

Definition
glycoside hydrolase family 5 protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ttt  Thielavia terrestris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_72629
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     THITE_72629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3159852..3160217,3160287..3161031,3161120..3161181)
Genome map
AA seq 390 aa AA seqDB search
MKSSVVVSLFASGAAAQVGPWGQCGGINWTGGTTCVSGYHCVYQNDWYSQCLPGADSTTL
KTSTTSTKPTSTSTAPATTTSAAAKGKLKWLGINQSCAEFGQGTYPGTWGKDFTFPSTSS
IQTHINDGYNIFRVAFAMERLVPNSLTGSPDAGYLKNLTDTVNFITNAGAYAILDPHNFG
RYYGNIITDTTAFGAFWTTVAKQFASNSRVIFDTNNEYHDMDQTLVLNLNQAAINAIRGA
GATSQYIFAEGNSYTGAWTWNTTNTNLAALSDPQNKLVYEMHQYLDSDGSGTSATCVSSD
IGVQRIVGATSWLRANGKIGILGEYAGGANSVCQTAVTGLLDHLQANSDVWAGALWWAGG
PWWGNYIFSFEPPSGTAYTYYNSLLKQYTP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtccgtcgtcgtcagcctcttcgcctccggtgcggctgcccaggtcggcccc
tggggccagtgtggcggcatcaactggacgggtgggacgacgtgtgtttcgggctaccac
tgcgtctaccagaacgactggtacagccagtgcctgcccggtgccgactcgacgaccctg
aagacgtcgaccacctccacgaagcccacgtcgacttccaccgccccggccacgacgact
tctgccgccgccaagggcaagctcaagtggctcggtatcaaccagtcgtgcgccgagttt
ggacaaggcacgtaccccggcacttggggcaaggacttcaccttcccgtccacctcgtcg
atccagacgcacatcaacgatggctacaacatcttccgcgtggccttcgccatggaacgg
ctggtgcccaattccctgacggggtcgcctgacgcgggctacctcaagaacctgaccgac
acggtcaacttcatcaccaacgcgggcgcgtacgccatcctcgacccgcacaacttcggc
cggtactacggcaacatcatcacggacacgaccgccttcggcgcgttctggacgaccgtc
gccaagcagttcgcgtccaactcgcgcgtcatcttcgacaccaacaacgagtaccacgac
atggaccagacactcgtgctgaacctcaaccaggccgccatcaatgccatccgcggcgcg
ggcgccacgtcgcagtacatcttcgccgagggcaactcgtacacgggcgcgtggacgtgg
aacacgaccaacacgaacctggcggcgctctcggacccgcagaacaagctggtctacgag
atgcaccagtacctcgacagcgacggctccggcaccagcgccacctgcgtcagcagcgac
atcggcgtgcagcgcatcgtcggcgccaccagctggctgcgcgccaacggcaagatcggc
atcctcggcgagtacgccggcggcgcgaactccgtctgccagaccgccgtcaccggcctg
ctcgaccacctccaggccaacagcgacgtgtgggccggcgctctctggtgggccggcggc
ccctggtggggtaactacatcttttcgtttgagcctccctcgggcactgcctacacctac
tacaactcgctgctgaagcagtacactccctga

DBGET integrated database retrieval system