KEGG   Thielavia terrestris: THITE_75273Help
Entry
THITE_75273       CDS       T02228                                 

Definition
histone deacetylase-like protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     THITE_75273
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THITE_75273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1345853..1346220,1346350..1346524,1346592..1346684,1346755..1346818,1346894..1348479))
Genome map
AA seq 761 aa AA seqDB search
MEDLDNDVVMDGEDHHMAEGPSTANGFLDTTTGESSLQTTNGNSADGTMQDEDQDADPTA
YPERLRRRGLLPTGCCYDDRMKLHANADFGPNPHHPEDPSRIECIMKTFKQAGLVFTGSD
AELIRIIQTEPTKYMWRIPARAATKEEICTVHHPAHYMWVEELSRMSTHELRKLSKEKDQ
GRDSLYVGSMTYEASLISAGGAIETCKSVVAGIVKNAFAVIRPPGHHAEFDTPMGFCLFN
NVPIAAKICQADYPDLCRKILILDWDVHHGNGIQNLFYDDPNILYISLHVYRNGEFYPGQ
PDNPMTPDGGLEHCGAGPGLGKNVNIGWHDQGMGDGEYMAAFQKIVMPIAHEFNPDLVII
SAGFDAAAGDELGACFVTPGCYAHMTHMLMSLAGGKVAVCLEGGYDLEAISKSALAVAQT
LMGEPPPKMEIPRISREAAKVLAKVQAYQAPYWECMRPGIVDVQELQAQDSSRLHDVVRS
AQRQVLSQKHGMLPLYIQRDVLFKSFENQVLVTRDIHAARKILVIVHDPPELHAQPDPLD
NTVEPHNAWVTDGVTRYIDWAISKGFGVIDVNVPHYITHPGDTEPYIPGADERTLQAQIQ
ELMCYIWDNYLQLSESADDIFLMGVGNAYLGIKMLLINRLDVKSRVAGVVNFVNGSLRPV
KSDADADLSSWYKDNSQVYVANDHACWADPDLTRKVMKRRFGNVIRSPANGLTPMMTEHF
ADVQQFFADRALGDGEGEGEGEGEGEGEDVGGKVEGGMRIG
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcttgacaacgatgttgtcatggatggtgaggaccaccacatggcagagggc
ccgtccaccgccaacggctttctagataccacgacaggggagagctcgctgcagacaacc
aacggcaacagcgcagatggcaccatgcaggatgaagatcaggatgccgacccgacagca
tatcccgaacgcctgcgccggcgcggcctgcttccgacggggtgctgctatgatgaccgc
atgaagctgcatgccaacgctgactttgggccaaatccccatcacccagaggatccttct
cggatcgaatgcatcatgaagacgttcaagcaggccggcctggtgttcaccggctccgat
gccgagcttatccgtatcatccagacggagcccacgaagtacatgtggcgcattcctgcg
cgagcggcgacgaaggaggagatctgcaccgtccaccatccggctcactacatgtgggtt
gaagagctgtctcggatgtctacacacgagctccgcaagctctccaaggaaaaggaccag
gggcgggactcgctgtatgtcggcagcatgacatacgaggcttcgctgatctcggccggc
ggcgccatcgaaacctgcaagagcgtggttgccggcatcgtcaagaacgctttcgccgtt
attcggccgccgggacaccatgccgagttcgatacgccaatggggttctgcctgttcaac
aacgtgcccatcgctgccaagatctgccaggccgactacccggacttgtgccgcaagatc
ctcatcctcgactgggacgtgcaccacggcaacggcatccagaacctcttctacgacgac
ccgaatatcctctacatctcgctccatgtctatcgcaacggcgagttctaccccggccag
ccggacaatccgatgacgccggacggcggtctcgagcactgcggcgccgggccgggcctg
ggcaagaacgtcaacatcggctggcacgaccagggcatgggcgacggcgagtacatggcc
gccttccagaagatcgtcatgccgatcgcgcacgagttcaacccggacctggtcatcatc
tcggcgggcttcgatgcggccgccggagacgagctcggcgcctgcttcgtcacgcccggc
tgctacgcccacatgacgcacatgctcatgtcgctcgccggcggcaaggtggccgtctgt
ctggagggcgggtacgacctcgaggccatctccaagtcggccctggccgtggcgcagacg
ctcatgggcgagccgccgccgaagatggagatcccccgcatcagccgggaggcggccaag
gtgctggccaaggtgcaggcctaccaggcgccctactgggagtgcatgcggcccggcatc
gtcgacgtccaggagctgcaggcgcaggactcgtcgcgtctgcacgacgtcgtccgctcg
gcgcagcgccaggtcctgtcgcagaagcatggcatgctgccgctgtacatccagcgtgat
gtgctgttcaagtcgttcgagaaccaggtgctggtgaccagggatattcacgcagcgcgc
aagattctggtcattgtgcacgacccacctgagctgcatgctcagcctgacccgctagac
aacacggtcgagccgcataacgcttgggtgacggacggcgtcactcggtacattgactgg
gccatcagcaagggcttcggcgttatcgacgtcaacgtcccgcactatatcacgcatcca
ggggacactgagccctacatccccggcgcagacgagcgcacgctgcaggcgcagattcaa
gagctgatgtgctacatctgggataactacctgcagctctccgaaagcgccgacgatatc
ttcctcatgggcgtcggcaacgcctacctcgggatcaagatgttgctgattaacagactc
gacgtcaagtcccgtgtcgcgggcgtagtcaacttcgtcaacggcagcctgcggccggtc
aagtcggacgccgacgccgacctgtcgtcgtggtacaaggacaactcgcaggtctacgtc
gccaacgaccacgcctgctgggccgacccggacctcacccgcaaggtcatgaagcgccgc
ttcggcaacgtcatccgcagccccgccaacggcctcacgcccatgatgacggagcacttt
gccgacgtgcagcagttctttgcggatcgcgcgctcggtgacggtgagggcgagggcgag
ggcgagggggaaggggagggggaggacgtggggggaaaggtagagggggggatgcggatc
gggtaa

DBGET integrated database retrieval system