KEGG   Teredinibacter turnerae: TERTU_0174Help
Entry
TERTU_0174        CDS       T00952                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00230  Purine metabolism
ttu01100  Metabolic pathways
Module
ttu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TERTU_0174 (gmk)
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TERTU_0174 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA AAA_22 AAA_16 MMR_HSR1 AAA_30 ABC_tran EFP
Motif
Other DBs
NCBI-ProteinID: ACR13474
UniProt: C5BLF7
Position
complement(192085..192702)
Genome map
AA seq 205 aa AA seqDB search
MLSTGTLYTVSAPSGAGKTSLVKAVVDAVDNLLVSVSHTTRAQRPGEVDGINYHFVDRTQ
FEQMVENGDFLEHAQVFTNAYGTSKNWVLETLGAGKDVILEIDWQGAHQVRQLIPSAVSL
FILPPSRETLRQRLTGRGQDNDSVIDARMAEAESEMSHYGEADYLIVNDNFNVALNEFRA
IIIANRLTLEKQRLRHQSLLNNLLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctctccactggcacactctatactgtttccgcgccctccggtgcgggtaaaaccagc
cttgttaaggctgtcgtcgatgcggttgacaacctgctggtctccgtctcgcacaccact
cgcgcccagcgccccggtgaggttgacggcatcaactaccactttgtcgaccgtacccaa
tttgaacagatggtggaaaacggtgattttctcgagcacgcccaggtctttaccaacgcc
tatggcacctccaaaaactgggtgctggaaacgctcggcgctggtaaagacgtcatttta
gagattgactggcagggcgcgcatcaggtgcgccagctgatccccagcgcggtcagcctg
tttattctgcccccttcccgggaaaccttgcgacagcgccttaccggtcgcgggcaggac
aacgattcggttatcgatgcccgcatggcggaagccgagagcgaaatgtcccattacggc
gaagcggactacctgatcgttaatgataatttcaatgttgctttgaacgaattccgtgcg
attatcattgcgaatcgcttaacacttgaaaaacaacggctgagacatcaaagtctctta
aacaacctattgtcctga

DBGET integrated database retrieval system