KEGG   Teredinibacter turnerae: TERTU_0186Help
Entry
TERTU_0186        CDS       T00952                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_0186
   00030 Pentose phosphate pathway
    TERTU_0186
   00051 Fructose and mannose metabolism
    TERTU_0186
   00052 Galactose metabolism
    TERTU_0186
   00500 Starch and sucrose metabolism
    TERTU_0186
   00520 Amino sugar and nucleotide sugar metabolism
    TERTU_0186
  Nucleotide metabolism
   00230 Purine metabolism
    TERTU_0186
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TERTU_0186
Enzymes [BR:ttu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TERTU_0186
    5.4.2.8  phosphomannomutase
     TERTU_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201152..203689
Genome map
AA seq 845 aa AA seqDB search
MTEQFQKFSDPGRSKPKSAEVDPPVEPKGKISPVLVSVLACVVLAAALSSWLCYHTYQTQ
IVAQRDAQLAELSQQRASLTAQNIHLYMARVSEAIAQFADKPLLKTALEANDETQLQRFV
AGFQGQLDGALKVRVFPRGTARLDNDIYPPIRFSELELIGLAERQEVALPEAARINNEWL
ITMVAPVVQDNTRLVYGTVMVSLRAAVLAPLLAQNNTGLGQVTLQQVFDTGAPTTLISVA
GAPVAPAVVVPVKDSHWQVVFAAGPALVAQTGTNGLWQLAGVALGCIFLIALSAWFGRQL
GTRIAAAREDKAKGTWKTIQAVASAGKDVAFTDPIFQRRDILDVEIANEDEALLALDEKA
QKPEQTIKDEQLDDSANETEQSSIAISETIFRAYDIRGIYGREITKDVAYLVGQALGSEA
MDVGDDTLIVARDARLHSPQLTEFLIRGILSTGCHVLNIGTVPTPLLYFATETLADSGSG
VMVTASHNPADHNGFKVVMGGKCRSEEDIKAIRSRILSKNIYTGSGEERRKDIVPDYINT
IFSDVALAGDISIVIDAANAVPGVIAPRLFEELGCHVTPLNCELDGSFPNHSPDPSIEEN
LQPLIAKVQEVGADLGIALDGDGDRLVVVTPQGKILWPDRLLMLFAKDIVARNPGADVVF
DVKSTRHLANVITSSGGRPIIWKTGHSPMKLKMAESGALLGGEYSGHIFIKDRWYGFDDG
LYAAARLIEIVSLQGQTLDEVFADFPESPSTPEIRVSVPEESKFALVEQLIERGEFGDGK
KTTLDGLRIDYSNGWGLVRASNTSAHLTMRFEADDEASLHTLKALFVRQLREIDSTLKID
WDQTN
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcagtttcaaaaattttcagatcctggacgcagtaagccaaaaagtgcggaa
gtggacccccctgtcgagccgaaaggcaaaatttcgccagtactagtttccgtacttgcc
tgcgtggtgttagccgctgcgttatcgtcctggctgtgctaccacacctaccaaactcag
attgttgctcagcgcgacgcgcagcttgctgaattatctcagcaacgcgcttcgctgacg
gcacaaaatattcacctgtacatggcccgggtaagcgaggcaatcgcgcagtttgccgat
aaacccttgctgaaaactgcgttggaggccaacgacgagacgcagcttcaacgctttgtt
gccggatttcagggacagctggatggcgcgcttaaagttcgggttttccctcgcggcact
gcgcgattggacaacgatatttacccgccgattcgattttcggaactggagctgatcggc
ttggcggaacggcaggaagtcgcattgccagaagccgcccggattaacaacgagtggctg
attaccatggtcgcgccggttgtacaggacaatacgcggttggtgtacggtaccgtgatg
gtgagcttgcgcgccgcagttctggcgccactgctcgcgcaaaacaacaccgggttgggg
caagtgaccttacagcaagtgttcgacaccggtgcccctaccaccttaatttctgtggcg
ggagcaccggttgcccccgccgtggtggtgcctgttaaagacagccattggcaagtggtg
tttgccgcaggccccgcattggtcgcgcaaactggaaccaacgggctatggcagctggcg
ggtgttgccctcggatgtatttttctcattgcgctctcggcctggttcggccgtcaactg
ggtacgcgtatcgccgctgcgcgagaagacaaagcgaaaggcacctggaaaaccattcag
gcggtagcatctgctggcaaagatgtggctttcaccgacccaatttttcaacgtcgcgat
attctcgatgtggaaattgccaatgaggacgaggcgctgttggcgctggatgaaaaagca
cagaaaccagagcagacaattaaagacgaacagctggacgattccgctaacgagaccgag
cagtcgtcgattgctatttcagaaactatttttcgcgcatacgatattcgtggtatttac
ggcagagaaatcacgaaagacgtggcgtatctggttggccaagcgctgggtagcgaagca
atggatgtgggtgacgacaccttgattgttgcccgtgacgcacgtttgcatagtccccag
ttaacggaatttttaattcgtggaattctcagtacagggtgccatgtattgaatatcggc
acggtgccaacgccgttactctattttgccacggaaacactcgcagacagcggcagcggc
gtaatggtgactgccagccacaacccggcagaccacaacggatttaaagtggtgatgggt
ggcaaatgtcgatcggaagaggatattaaagcaatccgctcgcgtatcctcagcaaaaat
atttacacaggttccggggaagagcggcgcaaggatattgtgccggattacattaatacc
atattttcagatgtggctctggctggcgacatctcaattgtcatcgatgcggcgaacgcg
gtacctggcgttattgctccacggttgttcgaggaactgggctgccatgtcacaccatta
aattgtgagctcgacggcagttttcccaaccactcaccggacccttcgattgaagaaaac
cttcagccattgattgctaaagtacaggaagtcggcgccgatctgggcattgcgctggat
ggcgatggcgaccgtctggtggtggttacaccgcaaggtaaaattctctggcctgatcgt
ttgctgatgttgttcgcaaaagatattgtggcgcgcaacccgggcgctgatgtggtgttt
gacgtgaagagcacgcgccaccttgccaacgtcattaccagcagtggcggccgcccgatt
atctggaaaaccggtcattcacctatgaagttaaaaatggcagaatccggtgcgctactt
ggcggcgaatattctggccatatttttataaaagatcgctggtacggatttgacgacggg
ctctacgcggcggcacggctaatagaaattgtgagtttgcaggggcaaacgctcgacgag
gtatttgctgattttcctgaatcaccatccactccagagattcgcgtgagtgtgcccgaa
gagagtaaatttgcccttgtcgaacagcttatagagcgtggcgagttcggcgatggcaaa
aaaaccacattagacgggttgcgcattgactattcgaacggttgggggctggtgcgtgca
tccaatacatctgcgcacctgacaatgcgattcgaagcggatgatgaagcgtcactgcat
acgctgaaagcgttgttcgtgcgtcaattacgggaaatcgacagtacattaaaaatagat
tgggatcagacaaactaa

DBGET integrated database retrieval system