KEGG   Teredinibacter turnerae: TERTU_0339Help
Entry
TERTU_0339        CDS       T00952                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ttu  Teredinibacter turnerae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERTU_0339
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERTU_0339
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_0339
Enzymes [BR:ttu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TERTU_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
355679..357853
Genome map
AA seq 724 aa AA seqDB search
MKLSLKNSSYMDANFYNFINEDVLPLAGVSRADFWRELEVLVDRFSPENQQLLFQRDALQ
AQIDEWHKSHQGELFDAALYTAFLTEIGYLEPEADDFQVTTENVDAEIAQLAGPQLVVPL
KNARFALNAANARWGSLYDALYGTDVIPYDAGLKPGKRYNPARGQQVIQSGRDFLDEIFP
LETGSHHNVSSYVVYYQHLLAFFADGSETGLQDPGQFVALNGHKENPESILLKNNGLHVE
LVFDRHGEVGKNDLANLQDIQIEAALTTIMDCEDSVAAVDAEDKLEVYRNWLGLVRGDLT
AVFDKGGVAHTRRMNCDRVYTAGDGEEYRLPGRSLMLVRNVGLAMNCDIMQTSQGEFVPE
GIIDAVVTGLIGAIDIRDSARKKRNSRTGSVYIVKPKLHGSREVAFTCALFSAVEELVGL
TPNTLKIGIMDEERRTTLNLKACIREARERVVFINTGFLDRTGDEIHTSMHAGAFMPKAW
LKEQPWITAYENNNVDVGLACGLPGHGQIGKGMWPMPDEMEKMMASKIAHPRAGANTAWV
PSPTAAVLHALHYHRVDVGEVQDGLRERAPAARAEIMQIPLLSAEDTLSSADIERELENN
IQGILGYVVRWVELGIGCSKVPDINDIGLMEDRATLRISSQHIANWLLHGLCSLDQLDTL
LLRMAAVVDAQNAATDGYQPMATDPATNLALQAARDLIVLGAEQPNGYTEHLLQKYRLQQ
KQRA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcactgaaaaattctagctatatggatgcaaacttttataactttattaat
gaggacgtgctgcctctggctggcgtttcccgcgcggacttctggcgcgaattggaagtt
ctggtcgacagatttagcccagagaatcagcaactgctatttcaacgggatgcgttgcaa
gcgcaaattgatgagtggcacaaatctcatcagggagaattgtttgatgcagcactttac
accgcgtttttaaccgagattggctacctggaaccggaagcggacgattttcaggtaacg
accgaaaacgtggatgcggaaatcgcgcagcttgctggtccgcagctggtggttccatta
aaaaatgcccgctttgcactgaacgctgcaaacgcccgctggggcagcctttacgatgcc
ctgtacggcaccgatgtgattccttatgacgcggggctcaagccgggcaagcgctataac
cccgcacgcgggcaacaggttattcagtcggggcgcgattttctcgacgaaatatttccg
ctggaaaccggatctcaccacaacgttagcagttacgtggtgtattaccagcatctcctc
gcatttttcgccgacggtagcgaaaccggtttacaggaccccggccagtttgtggcactg
aatggtcacaaggaaaatccggaatcgattttattaaaaaataacggcctgcatgtggag
ctggtgttcgaccgccatggcgaggtcggcaaaaatgatcttgcgaacctgcaggacatt
cagattgaagcggcgcttaccaccattatggattgcgaggattctgttgccgccgtcgat
gcggaagacaagctggaggtgtatcgcaactggctgggtttagtgcgcggagacttaacc
gcggtattcgataaaggcggtgttgcccatacacggcgcatgaactgcgaccgggtgtat
accgctggcgatggtgaggaatatcgcctgccgggtcgctcgctgatgctggtgcgcaat
gtgggcctggcgatgaactgcgacattatgcaaaccagtcagggcgagtttgtacccgaa
ggtattattgatgcggtggtgaccggtttaattggcgctatcgacattcgcgacagcgcg
cgcaaaaagcgcaacagtcgcaccggcagtgtgtatatcgttaaacccaagctccacggc
tcgcgggaagttgcatttacctgtgcgctcttttctgcggtggaagaattggtggggcta
acgccgaataccttaaaaattggcattatggatgaagagcgtcgcaccacactcaactta
aaggcctgcattcgcgaagctcgtgagcgggtggtttttatcaataccgggtttctcgat
cgcaccggcgacgaaattcataccagcatgcacgcgggtgcatttatgccaaaagcgtgg
ctgaaagaacagccgtggattaccgcttacgaaaataacaatgtggatgttgggctggcg
tgtggtctgcctggacacggccagatcggcaaaggcatgtggccaatgccggacgaaatg
gaaaaaatgatggcgagcaaaatcgcgcacccgcgcgccggggccaatacggcctgggtg
ccctcaccaaccgcggccgtactgcatgcactgcattatcaccgggtggatgttggcgag
gtgcaggatggcctgcgtgagcgggcaccggcagcgcgcgccgagattatgcagattccg
ttgttatccgcagaggacaccctgagttcggcagatattgaacgggagctggaaaacaat
attcaggggattttgggctatgtggtgcgctgggttgaactgggcattggctgctccaaa
gtgccggatattaacgacattgggttgatggaagaccgcgcaaccttgcgtatttccagt
cagcacattgccaactggctgctacatgggctgtgcagtcttgaccaactcgacacactt
ttgctgcgcatggccgcagtggtagatgcgcaaaacgcggctaccgatggttaccaaccc
atggcgaccgaccccgcaaccaacctggccttgcaggcggcgcgcgaccttattgtattg
ggtgccgaacaacccaatggctataccgagcatttactgcagaaataccgattgcagcaa
aagcagcgggcttaa

DBGET integrated database retrieval system