KEGG   Teredinibacter turnerae: TERTU_0339Help
Entry
TERTU_0339        CDS       T00952                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ttu  Teredinibacter turnerae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERTU_0339
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERTU_0339
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_0339
Enzymes [BR:ttu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TERTU_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
355679..357853
Genome map
AA seq 724 aa AA seqDB search
MKLSLKNSSYMDANFYNFINEDVLPLAGVSRADFWRELEVLVDRFSPENQQLLFQRDALQ
AQIDEWHKSHQGELFDAALYTAFLTEIGYLEPEADDFQVTTENVDAEIAQLAGPQLVVPL
KNARFALNAANARWGSLYDALYGTDVIPYDAGLKPGKRYNPARGQQVIQSGRDFLDEIFP
LETGSHHNVSSYVVYYQHLLAFFADGSETGLQDPGQFVALNGHKENPESILLKNNGLHVE
LVFDRHGEVGKNDLANLQDIQIEAALTTIMDCEDSVAAVDAEDKLEVYRNWLGLVRGDLT
AVFDKGGVAHTRRMNCDRVYTAGDGEEYRLPGRSLMLVRNVGLAMNCDIMQTSQGEFVPE
GIIDAVVTGLIGAIDIRDSARKKRNSRTGSVYIVKPKLHGSREVAFTCALFSAVEELVGL
TPNTLKIGIMDEERRTTLNLKACIREARERVVFINTGFLDRTGDEIHTSMHAGAFMPKAW
LKEQPWITAYENNNVDVGLACGLPGHGQIGKGMWPMPDEMEKMMASKIAHPRAGANTAWV
PSPTAAVLHALHYHRVDVGEVQDGLRERAPAARAEIMQIPLLSAEDTLSSADIERELENN
IQGILGYVVRWVELGIGCSKVPDINDIGLMEDRATLRISSQHIANWLLHGLCSLDQLDTL
LLRMAAVVDAQNAATDGYQPMATDPATNLALQAARDLIVLGAEQPNGYTEHLLQKYRLQQ
KQRA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcactgaaaaattctagctatatggatgcaaacttttataactttattaat
gaggacgtgctgcctctggctggcgtttcccgcgcggacttctggcgcgaattggaagtt
ctggtcgacagatttagcccagagaatcagcaactgctatttcaacgggatgcgttgcaa
gcgcaaattgatgagtggcacaaatctcatcagggagaattgtttgatgcagcactttac
accgcgtttttaaccgagattggctacctggaaccggaagcggacgattttcaggtaacg
accgaaaacgtggatgcggaaatcgcgcagcttgctggtccgcagctggtggttccatta
aaaaatgcccgctttgcactgaacgctgcaaacgcccgctggggcagcctttacgatgcc
ctgtacggcaccgatgtgattccttatgacgcggggctcaagccgggcaagcgctataac
cccgcacgcgggcaacaggttattcagtcggggcgcgattttctcgacgaaatatttccg
ctggaaaccggatctcaccacaacgttagcagttacgtggtgtattaccagcatctcctc
gcatttttcgccgacggtagcgaaaccggtttacaggaccccggccagtttgtggcactg
aatggtcacaaggaaaatccggaatcgattttattaaaaaataacggcctgcatgtggag
ctggtgttcgaccgccatggcgaggtcggcaaaaatgatcttgcgaacctgcaggacatt
cagattgaagcggcgcttaccaccattatggattgcgaggattctgttgccgccgtcgat
gcggaagacaagctggaggtgtatcgcaactggctgggtttagtgcgcggagacttaacc
gcggtattcgataaaggcggtgttgcccatacacggcgcatgaactgcgaccgggtgtat
accgctggcgatggtgaggaatatcgcctgccgggtcgctcgctgatgctggtgcgcaat
gtgggcctggcgatgaactgcgacattatgcaaaccagtcagggcgagtttgtacccgaa
ggtattattgatgcggtggtgaccggtttaattggcgctatcgacattcgcgacagcgcg
cgcaaaaagcgcaacagtcgcaccggcagtgtgtatatcgttaaacccaagctccacggc
tcgcgggaagttgcatttacctgtgcgctcttttctgcggtggaagaattggtggggcta
acgccgaataccttaaaaattggcattatggatgaagagcgtcgcaccacactcaactta
aaggcctgcattcgcgaagctcgtgagcgggtggtttttatcaataccgggtttctcgat
cgcaccggcgacgaaattcataccagcatgcacgcgggtgcatttatgccaaaagcgtgg
ctgaaagaacagccgtggattaccgcttacgaaaataacaatgtggatgttgggctggcg
tgtggtctgcctggacacggccagatcggcaaaggcatgtggccaatgccggacgaaatg
gaaaaaatgatggcgagcaaaatcgcgcacccgcgcgccggggccaatacggcctgggtg
ccctcaccaaccgcggccgtactgcatgcactgcattatcaccgggtggatgttggcgag
gtgcaggatggcctgcgtgagcgggcaccggcagcgcgcgccgagattatgcagattccg
ttgttatccgcagaggacaccctgagttcggcagatattgaacgggagctggaaaacaat
attcaggggattttgggctatgtggtgcgctgggttgaactgggcattggctgctccaaa
gtgccggatattaacgacattgggttgatggaagaccgcgcaaccttgcgtatttccagt
cagcacattgccaactggctgctacatgggctgtgcagtcttgaccaactcgacacactt
ttgctgcgcatggccgcagtggtagatgcgcaaaacgcggctaccgatggttaccaaccc
atggcgaccgaccccgcaaccaacctggccttgcaggcggcgcgcgaccttattgtattg
ggtgccgaacaacccaatggctataccgagcatttactgcagaaataccgattgcagcaa
aagcagcgggcttaa

DBGET integrated database retrieval system