KEGG   Teredinibacter turnerae: TERTU_0340Help
Entry
TERTU_0340        CDS       T00952                                 

Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00630  Glyoxylate and dicarboxylate metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01200  Carbon metabolism
Module
ttu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_0340
Enzymes [BR:ttu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TERTU_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACR12489
UniProt: C5BM79
Position
357921..359519
Genome map
AA seq 532 aa AA seqDB search
MNTYTNEIKNINRTLEQQGASWSAINAESVARMRLQNRFATGLDIARYTAKIMREDMAAY
DRDPANYTQSLGCWHGFVGQQKMISIKKHFGETKGRYLYLSGWMVAAMRSEFGPLPDQSM
HEKTAVPDLIAELYTFLKQADARELHHLFKELDKARAGRDHVRERYVQKAVDGFQTHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKI
HAVRYAFMELGVEDGVIVARTDSLGAGLTQKIPVSTSAGDLAQQYNAYIDGEAISDLREI
APGDLVLAQGDGCIKVKRLANGLVKFKPNTGEDRVVLDCITSLQHGADLLWIETEKPHIG
QIAGMVNRIRAQVPNAKLVYNNSPSFNWTLNFRQQVFDAWQQEGRDLTEYHRENLMSVEY
DTTPLAQEADERIRTFQRDAAQQAGIFHHLITLPTYHTAALSTDNLAKSYFGDQGMLAYV
ETVQRQEIRQSLACVKHQDMSGSNIGDDHKEYFSGGQALKAAGEANTMNQFS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttacactaacgaaattaaaaacatcaaccgtacacttgaacagcagggtgcc
agctggtcggcgatcaatgccgagagtgttgcccgtatgcggttgcaaaaccgctttgca
acaggattggatattgcacgctacacggcaaaaattatgcgcgaagacatggccgcatac
gaccgtgacccggcaaattacactcagtcgctaggctgctggcacggctttgtcgggcaa
caaaaaatgatttcgattaaaaagcatttcggcgaaaccaaaggtcgctatttgtatctt
tccgggtggatggtggctgcgatgcgctcggaatttggtcccttgccggaccagtccatg
cacgaaaaaacagccgtgcctgatttaatcgctgagttgtacacctttttaaagcaagcg
gatgcacgcgaactgcaccatttgtttaaagagctggataaagctcgcgccgggcgcgat
cacgtgcgcgagcgctatgtgcaaaaagccgtcgacggttttcaaacccatgtggtgccc
attattgcggacatagacgcaggtttcggcaatgaggaagcaacctatttactggcgaaa
aaaatgatagaggccggtgcctgctgtattcagatagaaaatcaggtgtcggatgcgaag
cagtgcggccaccaggacggtaaagtcaccgttccccacgaggattttctcgcgaaaatt
cacgcggtgcgttacgcctttatggaactgggcgtcgaagacggcgtgattgttgcgcgc
accgattcactcggcgcgggtcttacgcaaaaaataccggtgtccaccagcgctggcgat
cttgcgcagcagtacaacgcttatattgatggcgaggcaatttccgatttgcgcgagatt
gcaccgggtgacctggtgctggcacaaggcgatggctgtatcaaagttaaacgcttggcg
aatggcttggtgaaatttaaacccaataccggcgaagaccgggtggtgctggattgtatc
acctcgttgcaacacggcgccgatctgctgtggatcgaaaccgagaagccgcatattggc
cagatcgccgggatggtgaatcgcattcgcgcgcaggtaccgaatgccaagctggtgtac
aacaacagtccgtcttttaactggacacttaactttcgccagcaggtgtttgatgcctgg
cagcaggaaggccgcgaccttactgagtatcaccgtgagaacctgatgagtgtggaatac
gataccacgccactggcgcaggaagcggacgaacggattcgtacttttcagcgcgatgcg
gcacagcaagcgggtattttccatcacttgattacattgccaacctatcacacggccgcc
ctgtccacagacaatctggcgaaatcgtattttggcgaccagggcatgttggcttacgtg
gagacggtgcagcgccaggaaatccgccaaagcctggcctgtgttaaacaccaggatatg
tccggctcaaatattggtgacgaccataaggaatatttttctggcggtcaggcgctcaag
gcggcgggagaggcgaacacaatgaatcagttttcttga

DBGET integrated database retrieval system