KEGG   Teredinibacter turnerae: TERTU_0445Help
Entry
TERTU_0445        CDS       T00952                                 

Definition
glutathione peroxidase subfamily protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ttu  Teredinibacter turnerae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ttu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ttu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
458327..458872
Genome map
AA seq 181 aa AA seqDB search
MSAVQNIPVNRIDGEQQTLADYQGKVLLVVNVASKCGLTPQYEGLQKLYADKQGDGLEIL
GFPANNFMGQEPGSNEEIQEFCSLNFNVSFPMFEKISVLGDDKHPLYDALTDAQPSAEGD
GPFREKLKGHGVERDNPADILWNFEKFVVGRSGEVVARFAPDVTADDPRLVACIEAELAK
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgttcagaatattcctgtcaatcgcatcgatggcgagcaacaaaccctggcg
gactaccaaggtaaagttctcctggttgtcaatgtggcctcgaaatgtggcttaaccccg
cagtatgaagggttgcaaaaactctatgccgacaagcagggcgatggcctggaaatctta
ggttttcccgccaacaattttatggggcaggagcctggtagcaacgaagaaattcaagag
ttttgcagccttaactttaatgtcagcttcccgatgtttgaaaaaatctctgtactgggc
gacgacaagcacccgctgtacgacgccctgaccgacgcacaaccgagcgccgagggcgat
ggcccgttccgcgagaaattaaaaggccatggcgtagagcgggataacccggccgacatt
ttgtggaatttcgaaaagtttgtggtcggccgcagcggcgaggtggttgcgcgttttgct
ccggatgtaaccgcagatgatccgcgtctggtggcgtgtatcgaggcagaattagccaaa
tcctga

DBGET integrated database retrieval system