KEGG   Teredinibacter turnerae: TERTU_0505Help
Entry
TERTU_0505        CDS       T00952                                 

Definition
(GenBank) putative acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00360  Phenylalanine metabolism
ttu00362  Benzoate degradation
ttu00620  Pyruvate metabolism
ttu00621  Dioxin degradation
ttu00622  Xylene degradation
ttu00650  Butanoate metabolism
ttu01100  Metabolic pathways
ttu01120  Microbial metabolism in diverse environments
ttu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERTU_0505
   00650 Butanoate metabolism
    TERTU_0505
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TERTU_0505
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TERTU_0505
   00622 Xylene degradation
    TERTU_0505
   00621 Dioxin degradation
    TERTU_0505
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TERTU_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N Shikimate_DH Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACR14327
UniProt: C5BN11
Position
complement(519390..520367)
Genome map
AA seq 325 aa AA seqDB search
MASSAKLNVGIIGSGKIGTDLLIKIMRSRFLKCGLFVGRDYSSQGLQKAKSLGVQISDQS
IDAFSHSGQKFDVVFDATSAAFHKKHAEIFRIAGIKAIDLTPAKVGRFCVPSIDSDVVAT
EDNINMVTCGGQASVPIINTLSKVYPEISHIEVHSHLAEDSVGPGTLANIDEYYSSTSSA
IANYSGVSSVEVHLQVEHSSWKPDMLTVVRAHTTDANLEKLYGPLHARLQQVRAHVPGYH
IIGTPRYLNGAIEILISIRGQGDWVPSHAGNLDIINCAAIAIAEKYAQYKGIQESPATGP
QRVASVDKTRLDVFHSSKQPVAESA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccagctcagctaagctcaatgtgggaataataggttcagggaaaataggaacggat
cttcttattaaaataatgcgatccagatttttgaaatgtggacttttcgttggccgcgac
tacagctcgcaaggcttgcagaaagcaaaatctttgggcgttcagatatcagatcaaagc
atcgacgcgttttcccattcggggcaaaaattcgacgtagtgtttgatgcgacatcggcc
gcctttcacaagaaacatgccgaaattttccgtatcgccggtatcaaagcaattgatctg
actccggcaaaagttggtcgcttctgtgtgccttcgatcgacagtgacgttgttgcgacg
gaagataatatcaacatggtgacttgcggaggccaggcatcagtaccgatcatcaacacc
ctatcgaaagtttatcctgaaatatcccatatcgaagttcattcacacctggcagaagat
tctgtcggccccggtacgctcgccaatatcgacgaatattacagcagcacttcaagcgca
atcgccaattattccggtgtaagcagtgttgaggtacacctgcaggtcgagcacagtagc
tggaagccggacatgcttacggtggtgcgggcgcacacgacagatgccaacttggaaaaa
ctctatggccctctccatgcgcgcctacaacaagttcgcgcccatgttccggggtatcac
ataatcggaacaccgcgatacctgaacggcgccattgaaatactgatcagtatacgaggt
cagggagactgggtacccagccatgcaggaaatctggatatcatcaactgtgccgcgatt
gccatcgcagaaaagtatgcgcagtacaaaggtatccaggaaagtccagccactggccct
cagcgcgtagcgagcgtcgataaaacccggttagatgttttccattcaagcaagcaaccc
gttgccgaatcagcttga

DBGET integrated database retrieval system