KEGG   Teredinibacter turnerae: TERTU_0569Help
Entry
TERTU_0569        CDS       T00952                                 

Gene name
folK_1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ttu  Teredinibacter turnerae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585089..585571)
Genome map
AA seq 160 aa AA seqDB search
MQVFIGLGSNLDNPAAQLKSALAAIRAHSEIALICCSPFYRSIAVGPPQPDYVNAVAELQ
TNLKPEPLLDALQAIENDHGRVRTEHWGARTLDLDLLLYGDTTLNTVRLTVPHPWMTARN
FVLRPLCDIAPELVIPGGDAVESYLAGVGDQGLIRLDEDN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtttttatcggtctcggcagcaacctcgataaccccgctgcgcaattaaaatcc
gcgttggcggcgatacgtgcgcactcagaaatagcgttaatctgttgctcaccgttttat
cgcagcatcgccgtagggcccccacaacccgactatgttaacgctgtcgctgaactgcag
accaaccttaagcccgagccacttctcgatgccttgcaggcgattgaaaatgaccacggc
cgcgtgcggacagagcattggggcgcgagaacgctggatctcgatctgctcctctacggc
gacactaccctcaataccgtgcgcctgaccgtgccgcacccctggatgacagcccgcaac
ttcgtgctccgccccctctgtgatatagcacccgagctggtgattcccggtggcgatgca
gtggaaagctacctggcaggcgtcggcgaccaggggttaattcggttagacgaagacaac
tag

DBGET integrated database retrieval system