KEGG   Teredinibacter turnerae: TERTU_0607Help
Entry
TERTU_0607        CDS       T00952                                 

Definition
glycoside hydrolase family 9 domain-containing protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ttu  Teredinibacter turnerae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TERTU_0607
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TERTU_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623395..625137
Genome map
AA seq 580 aa AA seqDB search
MRHFLASLSFAAISSALVACSSGGGSKSEISDPASASEQAAELGLIKVNQVGYLPDGQKF
AVVPASAVRQFFLIDGNGEEVYKGKLEKTAGWEPAQERVALADFSDYEQPGRYRVKVEGF
PLSPAFVIAEDVYSDAHDAAIKAYYFNRASTALPDAFAGAWARPEGHPDDRVKVHWSAAS
GMRPEGTVLASPKGWYDAGDYNKYIVNSGISTYTLLAAYEHFSRFYDDRTWNIPESGDKL
PDLLNEILWNLDWMETMQDPADGGVYHKLTTLNFSGDVMPAEAIEQRYMVAKGTAATLDF
AAVMATASRVFVKWDAAQAIRYREAAVAAWRWAEANPQVVFSNPKDVHTGEYGDSDFADE
RAWAAAELFITTGDQVYYRAFKAVGAGAGVPSWGYVAPLAHVSLAFHSKDSLSSKEYEAS
VDALVSTANGLVDRYRDSAYRVSMTTQDFVWGSNSGAANQAFILLQAYRLTGEDKYRAAA
LGIVDYLLGKNPMDYSYVTAVGSKPPEHIHHRPSEADSVKAPVPGFLVGGPNAGQQDNCD
YRSLAPAKSYVDSWCSYASNEIAINWNAPLVYVLAGLMAD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagacattttttagccagcctttcttttgcggctatcagcagtgcgctcgtcgcctgc
agcagcgggggaggctccaaatcggagatcagtgatcctgccagcgctagcgagcaggct
gctgaactcggcctgattaaagtgaaccaggtggggtatttgccagatgggcaaaagttt
gctgtcgtacccgcatcggctgtgcgtcagttctttttgattgatggtaatggcgaagaa
gtctacaaaggcaaactcgaaaaaacggccggttgggagcctgcacaggagcgagtcgcg
ctggctgacttcagcgattatgagcaacccggccggtacagggtgaaagtggagggtttt
ccactctcgcctgcatttgtcatagccgaggatgtgtattcggatgcgcatgatgctgcg
ataaaggcctattactttaaccgcgccagcacagcgcttcccgatgcctttgccggtgcc
tgggcgcgcccggaaggccacccggatgatcgagtgaaagttcactggtcggctgcctcc
ggaatgcgacctgagggcactgtgttggcgtcgcctaagggctggtacgatgcgggcgat
tacaacaaatacatcgttaattcgggtatctccacttataccctgctcgccgcgtacgaa
catttcagccgtttttacgatgatcgcacttggaatatccccgagtctggcgacaagttg
ccggacctgctcaacgaaattttgtggaatctcgactggatggaaaccatgcaggacccc
gccgacggcggcgtctaccacaagctcactaccttgaatttttccggtgatgtaatgcca
gcagaggctatcgagcagcgctacatggtggcgaaaggcactgcggcaacgcttgatttt
gctgcggttatggcgacggcgagtcgagtatttgtgaagtgggacgcggcccaggcgata
cgctatcgagaggcagctgttgccgcttggcgctgggcagaagccaatccgcaggtggtg
tttagcaacccgaaggatgtgcatacgggagagtacggagacagcgatttcgctgacgag
cgcgcctgggctgcggcggaattatttattaccaccggcgatcaggtgtactaccgcgca
tttaaggcagtaggtgctggcgctggcgtgccttcctggggatatgttgcaccgctggcc
cacgtgtcgctcgccttccacagcaaagacagcctttccagtaaagagtacgaggcgtct
gtagacgctctagtgagtactgcaaacgggttggtagatcgctaccgcgatagcgcatac
cgggtctcgatgaccactcaggactttgtgtggggcagcaacagcggcgcggctaatcag
gcatttatcttgttgcaggcgtaccggctcactggggaagataaatatcgcgcagcagcg
ctcggaattgttgactatcttttaggcaagaatccaatggattacagctatgtcacggct
gttggcagcaagccacccgagcacattcatcaccgcccatctgaagcagatagcgtaaaa
gcaccggtaccgggatttctggtgggtggccccaatgctggccagcaggacaactgtgat
taccgctcgctggcgccagctaaatcctatgtcgacagttggtgtagctatgcctctaac
gagattgccattaactggaacgcccccctggtctacgtgttggcgggccttatggcggac
taa

DBGET integrated database retrieval system