KEGG   Teredinibacter turnerae: TERTU_0659Help
Entry
TERTU_0659        CDS       T00952                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ttu  Teredinibacter turnerae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ttu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ttu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674259..675917
Genome map
AA seq 552 aa AA seqDB search
MIRKCYLNAMLLALIGSCTASSVLAAKLSDADFLQYTGDARQWYSDGANAIEKKRALMHD
RSRGKAKNVILFIGDGMGVSTVTAARIFAGQLQGQSGEEFNLAFDEFPYTGLSRTYNTDM
QTPDSAGTMTALITGVKSRAGMLSVSDEISRSACSGQYDHSLASAVELAELAGMATGVVS
TARITHATPGATYATSSDRDWENDAEMPAAAKAAGCEDIAAQLAGFTPSLNQLAQQLAGK
KSKAPAIDGPEIILGGGARNFFPETPVTMDGKQFVGKRKDGRNLVAEWRQNNPGGAFVSD
AESLQQAVENPQGPVLGLFSNSHMAYESQRLHEEAAAQQPSLAQMTDAALEVLSKHKSGY
MLVVEAGRIDHAHHASNAYNALQDTVALSDAVALAAERTDPNDTLIIVTADHSHVFVMAG
YSARGNPILGKSKPKADGDYARDVNKLPYTTVGYLNGRGFAFDEGERDADSRYAAPVDAG
RKNLEKVNTQDPGFHQESLVPLNAETHGGEDVAIFARGPGAELVSGSNEQNVIFHIMNYS
AGLAEKAKKALR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtaaatgttatttgaacgctatgttgttggcgctgattggtagctgcacggct
tccagtgtgcttgccgcgaagttgtcggatgccgattttttacaatacaccggtgacgcc
cgtcagtggtacagcgatggcgccaacgcgattgagaaaaagcgggcgctgatgcacgac
cgcagccgcggcaaagctaaaaatgtaattctatttattggcgacggcatgggtgtgagt
acggtaactgccgcgcgtatttttgcagggcaattacaggggcagtctggcgaggagttc
aaccttgccttcgacgagttcccctacaccggcctgtcgagaacctacaacaccgatatg
caaacccctgactccgcaggcaccatgacggcgctgatcactggtgttaagagtcgtgca
ggaatgttgagtgtcagtgacgaaatcagccgcagcgcttgcagtggtcagtacgatcac
tcgttggcgtctgcggttgagctggctgagctggcgggaatggcgaccggtgtggtgtcc
actgcccgtattacccacgcgactcccggcgcgacctacgccacctcatccgaccgggat
tgggaaaatgatgcggaaatgccagcagcggcgaaagcggctgggtgcgaggatattgcc
gcgcagttggccgggtttacgccgagcctaaatcagttggcgcagcagttggcgggtaaa
aagagtaaagcgcccgcaatcgatggaccggaaattattctcggcggcggcgctcgcaac
tttttcccggaaacgccggtgacgatggatggcaaacagtttgtcggtaagcgtaaggat
ggccgtaacctggtggcagagtggcgacagaataaccctggtggtgcatttgtatccgat
gcggaaagtcttcagcaggcagtcgaaaatccccaggggcctgtgctcggtttgttcagc
aactcccatatggcgtatgaaagtcaacgcctgcacgaagaagcggcggcgcagcaacct
tcgctagcgcagatgacggatgccgcgttagaggtgctgagcaagcataaatccggctat
atgttagtggtggaggctggccgtattgaccacgcgcaccatgcgagtaatgcgtataac
gcactgcaggatactgtcgcgttatcggacgctgtcgcgctggcagccgagcggacggac
cccaacgacacgctgattattgttactgctgaccatagccacgtttttgttatggcgggc
tactcagcgcgcggtaacccgattctaggcaagtccaaacccaaagccgatggtgattat
gcccgcgacgtaaataaactgccgtacaccactgtgggctacctgaatggccgaggattc
gcgtttgatgaaggggagcgagacgccgactcccgttatgcagccccggtagacgccggc
cgaaaaaacctggaaaaagtgaacacgcaagacccgggattccatcaggaaagcctggtg
ccactcaatgcagaaacccacgggggtgaagatgttgctatttttgctcgcggcccagga
gcggagcttgtgtccggcagtaacgaacaaaatgtgattttccacatcatgaattacagc
gccggattggctgaaaaagcgaaaaaagcgttgcgttaa

DBGET integrated database retrieval system