KEGG   Teredinibacter turnerae: TERTU_0736Help
Entry
TERTU_0736        CDS       T00952                                 

Definition
xylanase (EC:3.2.1.-)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     TERTU_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761866..763005
Genome map
AA seq 379 aa AA seqDB search
MTINRRQFLLQSSATLAALATIKQRALAKALEITSIKDLYKDDFYIGTAIGDRQMHEADP
KFMNLVAKEFNAVTMENSMKWERVHPRPGKWNWELADKFMDFADKHKMFKVGHVLVWHSQ
VPSWVFQDEAGKPLDRDALLARMRGHIGKIAGRYAGRMNSWDVVNEAIDEDKGWRKSPWF
NIIGPDFMDYAFNFARETDSSAQLVYNDYNMHNPGKRAFLVDYIRKAKKRGVPIQGVGLQ
GHVGLDFPDILEFEASLKAYAAEGMRLHITELDLDVLPVAWEFSGAEISASFEYSDKINP
YPNGLPAKVEQQLTDRYVEFFKLFLKYRDHIDRVTFWGVSDKNSWKNDFPVKGRTNYPLL
FDRNFERKPCYDAIAKLKI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaccgacgtcaatttttgcttcaatcctcggccaccttggctgctctcgcc
acaattaagcagcgcgcgctcgcgaaagcgctggaaatcacttccataaaagacctctac
aaagacgacttctacattggcacggccattggcgatcgtcagatgcatgaggccgaccca
aaattcatgaatctggttgccaaagaatttaatgcggtgactatggaaaactccatgaaa
tgggagcgtgtacaccctcgccccggcaagtggaattgggagctggcagacaaatttatg
gacttcgccgacaagcacaaaatgttcaaggtcggccacgttctggtttggcattcacag
gtaccgagttgggtatttcaggacgaggcaggcaagccgctggatcgagatgcgttattg
gcgcgcatgcgtggccatataggcaaaattgctggccgttacgccgggcgaatgaattcc
tgggatgtagtcaatgaggcgatagacgaagacaaggggtggcgtaagagcccctggttt
aacatcataggtccggattttatggactacgcgtttaattttgcgcgtgaaacggattca
tctgcacaactggtttacaacgattacaacatgcacaaccccggtaaacgcgcgtttctt
gtggattatattcgcaaggcaaaaaaacgcggcgtacctattcagggcgtcggcctgcag
gggcatgtggggctcgattttcccgatatcttggagttcgaagcgagtttaaaagcctac
gcggctgaaggtatgcgcctgcacattaccgaactggatttagatgtcttacctgtcgcc
tgggagttttccggcgcggaaatttccgcgagttttgagtattcagacaagatcaacccc
tacccgaacgggcttcccgccaaagttgagcagcagctaaccgaccgttatgtggaattt
ttcaaattatttttgaaatacagagaccatatcgatcgtgtgactttctggggggtaagc
gacaaaaactcctggaaaaatgacttcccggtaaaaggccgaactaattatcctctgttg
ttcgatcgcaatttcgaacgcaaaccctgctacgacgccatcgcaaaattaaaaatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system