KEGG   Teredinibacter turnerae: TERTU_0811Help
Entry
TERTU_0811        CDS       T00952                                 

Definition
glycoside hydrolase family 20 domain-containing protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ttu  Teredinibacter turnerae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TERTU_0811
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TERTU_0811
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TERTU_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854529..856901
Genome map
AA seq 790 aa AA seqDB search
MFKSKKIVAAIACLLIAGNAVAARISSSSLDSVPSLSVVPKPVSLTPGDGHFLFSPTTTI
TVNDERLKPVAELFADFFVKPSGIDLPVSLGDASAPIQIILVPAAQFGSDKSEAYRLQVT
ADRVHIVAPSEKGAFYALQTLRQLLPPQVESTTPVNYVRWDVPAVTVEDEPRFPYRGMHL
DVARSFMPAGFVKRYIDLLAFHKLNYFHWHLTDDQGWRIPIDAYPLLTEKSAWRDKTVVG
HTLDRNTEYDNNPTGGFYTKAEIRDIVAYAAQRQITVIPEIDIPGHGSTIIAAYPEFGCE
QQAAAADTFVQPNFGIFPAVLCPTEKTFQMLDTVFTEVAALFPGKYIHVGGDEVLKTQWE
QSSFANALMKDKGLKNYHELQSYFVARVGETLARLNRKMIGWNEILDGGVADDATIMSWQ
GIKGGIAAANLGHDAIMTPFGYTYFDFFQSDSVDEPMAIHGMTTLAKAYSYDPMPEELAG
TDKAHHILGAQGQLWTEYQTQPRKVEYMVLPRMSALAEVTWTAQGNKDWADYAARLPDLF
ARYDAMGVVASRSVYTPTINAERLGRGEKANYRITLNAETARTTIRYTTDGSQPNQQSSI
YKKPFKVNGGTVLRARAQDNVSGEFYPESRLRLLSHKAVGAEVEILTEFNASDDPSPAEQ
LTDGISHQDQIYQPSDWVIFYGDSADMVVDLGEPTSVQSVSFTFDAGKHRQLYPPSSVEI
FVSSDNSQWNSIATLQESHLLDARDKVRVEFPAENARYVKIVAGNRFTYKSNETGEHRKV
PLHIDELVIE
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatcaaaaaaaattgtagcagccattgcttgtctgcttattgcgggcaacgcc
gttgcagcgcggatttccagctcctccttagatagtgttccatcactctctgttgtgccc
aagccagtcagtctgacgcctggcgacgggcattttttattttcgccaaccaccacaatt
actgttaacgacgagcgtttaaagcccgttgctgaattgtttgcagacttttttgtcaag
ccgagtggtatcgatttgccggtaagccttggtgatgccagtgccccgatacagattata
ctggtaccagcggcgcagtttggcagcgataaatccgaagcctaccgccttcaggtgact
gctgatcgagtgcatattgttgcgcccagcgagaagggtgcgttttacgcattgcagacg
ctacgccagttgttgccaccgcaggtggaatccacaacgcctgttaactatgtgcgctgg
gacgtacccgccgttacggtcgaagatgaaccgcgttttccctatcggggtatgcatctg
gatgttgcgcgcagttttatgcccgccgggtttgtaaaacgctatatcgatttgctggcg
tttcacaagttaaattacttccattggcacctgaccgacgatcagggctggcgtattcct
atcgacgcctatccgctgctgactgaaaagtctgcctggcgcgacaaaaccgtagtgggg
cacaccttagaccgcaatactgaatacgataataaccccaccggcggcttttatacgaag
gcggaaatacgcgatattgtcgcctacgccgcgcagcgccagattaccgtgattcctgaa
atcgatattcctggccacgggtccactattattgcagcctaccctgaattcgggtgcgag
caacaggcggcagcagcagacacgtttgtgcagcctaatttcggaatttttcccgcagtc
ctgtgccctacagaaaaaacgtttcagatgctcgatacggtgttcaccgaggtggcagcg
ctgtttccaggtaaatacattcatgtgggtggcgacgaggtcttaaaaacccagtgggaa
caaagttcgttcgctaacgcgttaatgaaagacaagggattgaaaaattatcacgaacta
caaagctattttgtcgctcgggttggggaaactctggcgcgcttgaatcgtaaaatgatt
ggctggaacgaaattctcgacggtggcgttgctgatgatgcaaccatcatgtcctggcag
ggaattaaaggtggcatcgccgctgccaatctaggtcacgatgcgatcatgacacctttc
gggtacacctactttgacttttttcagtctgattccgtcgatgagccgatggcgattcac
ggtatgacgacacttgccaaagcgtattcctacgacccaatgccggaagaacttgcgggt
accgataaagcccatcatattcttggcgcacagggtcagctttggactgaataccaaact
caaccgcgcaaagtggagtacatggtactgccgcgtatgagtgcgctggcagaagtgaca
tggaccgcgcagggtaataaggattgggcggattacgccgcgcgcctgccggatctgttt
gcgcgctatgacgcaatgggcgttgtcgcctcgcgctctgtctataccccaacgattaat
gccgagcggcttggtcgtggcgaaaaagcaaattaccgtataacactcaacgcggaaacg
gcgcgcacaaccattcgatataccacagatggttcgcagccgaatcagcagtcttcgatc
tacaaaaagccgtttaaagtaaacggtggtactgtgttgcgtgcacgtgcgcaggataac
gtgagcggggagttttatccggagagtcgcttgcgtttgctttcgcacaaggccgttggc
gctgaggtcgagatactgactgaatttaacgcaagtgatgatccttcccctgcagaacaa
ctcaccgacggcatcagtcaccaggatcaaatatatcaaccgtcagactgggttattttt
tacggagacagtgcagatatggtagtggatctgggtgaaccaacctcggtgcagtcagtt
tctttcacgtttgatgccggaaagcaccgccagctgtacccgccatcgtcggttgaaatc
tttgtgtccagtgataacagtcaatggaacagtatcgcaacactgcaggagtctcacttg
ttggacgcacgggacaaagtccgggtcgaatttccagccgaaaatgcgcgctatgtaaaa
attgttgctggcaacaggtttacctataaaagcaatgaaaccggcgagcaccgcaaagta
cccttgcatatcgacgaattggtaatcgaataa

DBGET integrated database retrieval system