KEGG   Teredinibacter turnerae: TERTU_0935Help
Entry
TERTU_0935        CDS       T00952                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ttu  Teredinibacter turnerae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TERTU_0935 (malQ)
Enzymes [BR:ttu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TERTU_0935 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975863..978091
Genome map
AA seq 742 aa AA seqDB search
MSDLDRLFYWRGIASDYFNYRGEHVTVPVDNRLNLLATMGQDISNSQAIAEAAYELDVGP
WRHFLPPLQTSVLHDPGQSAEFYVNLHPARLAKELAWELRDSNQNVIDKGALLPKDVPEV
GDYVYEAARYSRRQISTNVTEPGYYTLTLSLSSAPDDPAVKLSDAEKLTEIEACLAVAPG
AVYQPSWLETGEKLWGFIVQLYTLRSDNDWGIGDFSDLKTLIVHAADAGADLIGLNPLHA
LLPDVGTNNSPYSPSDRRFINTLYIDPTAVHEFSEVEKATGRNLYKENAPLLSALRDANF
VDYASVKNIKYPVFEVLFDHFYEVSYKKKASHYTEFSSFLEEAGEPLYQFARFESIRNSW
QNSSFAAIGELDIPDGIGDLESLSLLTEDTQRIVLFHCYLQWLAHVQLEACQIQAVDCGM
KVGLIRDLAVGAEGGGAEVYSQPGQFCTRASVGAPPDPLAEQGQNWGLPPMDPAFLRETG
YAHFIQILRENMSLCGALRIDHAMSLMRLWWCPPGTTADHGAYVYYPFEDMLALLCLESY
LNQCAIVGEDLGVVPPEFREAITRAGIFTNRVFYFEKENYSYFKPPENYDVHALAMVNNH
DVPTLSSWWNGNDLVLRDKLGIFEEGVDYETMVEQRRLEKQQVLDFLLKQGELPPQWLDL
NIEREAEPTLINAILATVSRVASRLYVIQLEDVLLMDAPVNVPGTFKEYPNWQRKLSQPL
DVIFNQPQTQALLARVHSERNR
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttggatcgtctgttttactggcgcggaatcgctagtgattattttaactat
cggggcgaacacgtcacggttcccgttgacaacaggttgaacctgcttgcaacaatgggg
caggacatctcaaactcgcaggcgatagctgaagcggcgtatgaattggacgtggggccc
tggcggcacttccttcccccactccagacgagtgtgctgcacgacccgggtcaatcggca
gagttctacgtgaatctgcaccctgcgcgattggccaaagagcttgcttgggaattaaga
gacagcaatcaaaacgtgatcgataagggagcactactgccgaaggatgtgccagaggta
ggcgattatgtttacgaagctgcgcgctactcccgcaggcagatttctacgaatgttacc
gaacctggctattacacacttacgttatcactatcgtcggcacccgatgatccagcagtt
aaactttccgatgcagagaagcttaccgagatagaggcgtgtctcgcagtggcaccgggt
gcggtctaccaaccgtcctggctcgaaacaggagagaagctgtgggggttcattgtccaa
ctctacacgcttcgctctgacaacgactggggaattggcgatttttcagatttgaagacg
ctaattgtacatgccgcagacgccggcgcagatttgataggcttgaatcctctgcacgca
ttacttccggacgtcggcaccaacaatagtccatacagtccgagtgaccgcagatttatt
aatacgttatatatagatcctactgcggtccacgagttttctgaggtggagaaagcaaca
ggacgcaatctttataaggagaacgcgccgctgttgagtgcactgcgcgacgcaaacttt
gttgactacgcaagcgtaaaaaacattaagtaccctgtgttcgaggtgctgtttgatcat
ttctatgaggtgtcgtacaagaaaaaggccagccattacaccgaattttccagtttcctg
gaggaagccggggagccgctatatcagtttgctcgttttgaatcaattcgtaacagctgg
caaaacagctcgtttgccgctataggtgagttggatatacccgatggtattggagacctg
gaaagccttagtttactaactgaggacacacagaggatcgtcttgtttcactgttatctt
cagtggttagcgcacgtacagctggaagcgtgtcagatccaggcggtagactgcggtatg
aaagtgggcttgattcgtgatctggcggttggcgcggagggaggcggtgccgaggtatat
tctcagcctggccagttttgtactcgcgcgtctgttggcgcaccaccagaccccctcgcg
gagcagggccagaactggggcttaccgccgatggacccggcgtttttacgcgagaccggg
tatgcgcattttattcaaattttgcgtgagaatatgtcactgtgtggtgccttgcggata
gatcatgcaatgagcctgatgcggttgtggtggtgtcctccagggactactgcggatcac
ggggcctatgtctattatccatttgaggatatgttagcgctcttgtgtctggaaagttat
ctaaatcaatgcgcgattgtaggcgaagaccttggtgttgtaccgccagaattcagggag
gcgatcacgcgcgcaggtatatttaccaaccgggtcttttatttcgagaaagaaaattac
tcgtatttcaagccaccggaaaactatgatgtccacgcgctggcaatggtcaacaatcat
gatgttccaacgttaagcagttggtggaatggcaatgatctggtattgcgagacaagctg
ggaatattcgaagaaggcgtggattatgaaacgatggtcgagcagcggcgcctggagaaa
caacaggttctggattttctcctaaaacagggagaactgcctcctcagtggctcgattta
aatatagagcgagaagcggagccaacactcattaacgctattctggcaacggtttcccgt
gtcgcatcccgcttatatgttattcagttggaagatgtcttgctaatggatgcgccggtg
aatgtgccgggtacatttaaagagtatcccaattggcagagaaaactatcacagccattg
gatgtaatttttaaccaaccacagactcaagcgttactggcacgcgtacattctgaaaga
aaccgctag

DBGET integrated database retrieval system