KEGG   Teredinibacter turnerae: TERTU_0949Help
Entry
TERTU_0949        CDS       T00952                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ttu  Teredinibacter turnerae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TERTU_0949 (galU)
   00052 Galactose metabolism
    TERTU_0949 (galU)
   00500 Starch and sucrose metabolism
    TERTU_0949 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TERTU_0949 (galU)
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TERTU_0949 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997573..998406
Genome map
AA seq 277 aa AA seqDB search
MISKCLFPVAGYGTRFLPATKSMPKEMLPIVNKPLVQYGVEESLEAGLHEIGFVTGRGKR
AIADHFDVSYELEHQIAGSSKEQYLTSIREVIAKGSFSFTRQSEMRGLGDAILNGRRLIG
NQPFGVVLSDDLCVADEDGEGVLTQMVKLFKQFRCSIVAVQEVPEDQISKFGVIAGNPIK
DNIYQVNEMVEKPAPEDAPSNLAIIGRYILTPDIFEIIENTPPGKNDEVQLTDALMTQAK
NGCVLAYKFKGRRFDCGSVAGFVEATNFVYENVYSQE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaagtgtttattcccggtcgcagggtatggaacccgatttctgccagccact
aagtcaatgcccaaagaaatgctgccaatcgtcaataagccactggtgcagtatggtgtt
gaagagtcgcttgaggcgggcttgcacgaaatcggattcgtcactggccgtggcaaacgt
gctattgcggaccattttgacgtgagttacgagctggagcatcaaattgcaggttccagc
aaagagcagtacctcacctcgattcgcgaggttattgccaaggggtctttctcttttacc
cgtcagagcgagatgcgtggtctgggtgatgccattctcaatggccgtcgtttgatcggc
aatcaaccgtttggtgttgtgctttccgacgatttgtgtgttgctgacgaagacggtgaa
ggcgttttgacgcaaatggtaaagctgtttaagcagttccgctgcagcattgttgccgtt
caggaagtcccggaagatcaaatcagcaagttcggcgtcattgccggcaacccgatcaaa
gacaatatttatcaggttaatgaaatggttgagaagcctgccccggaagatgcgccgagt
aacctggcgattatcgggcgctacattctcaccccggatatctttgaaatcatcgaaaac
accccgcctggtaaaaacgacgaagtacagttgactgacgcactcatgacacaggccaaa
aacggctgcgttcttgcgtacaaatttaaaggccgccgcttcgattgtggtagtgttgca
ggctttgttgaagcgacgaatttcgtttacgaaaacgtttacagccaggaataa

DBGET integrated database retrieval system