KEGG   Teredinibacter turnerae: TERTU_1163Help
Entry
TERTU_1163        CDS       T00952                                 

Gene name
dsbC
Definition
protein-disulfide isomerase DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TERTU_1163 (dsbC)
Secretion system [BR:ttu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TERTU_1163 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1215619..1216413
Genome map
AA seq 264 aa AA seqDB search
MVALLGLSLAGLISCKSEAESSQASAKDPAPAASATQVSATQAEENIRKSLMVANENLRI
RKIQPSVIPGMYEVQIMGKGIIYMEENGQYFIDGQMLHLDGKKIVNVTDESMTGLRKDLL
ATVNKDDAIVFSPKGEVKASISVFTDVDCGYCQKLHREVPALNDMGIEVRYLAYPRAGLN
SMSYQKIASAWCADDPRKALTALKNREDIAMNVCEGNPVASEYELGQQMGVTGTPAIVLD
SGVLIPGYMPAKNLAERIGVTSGS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtggccctgctgggtttatctctggcaggactgatatcgtgcaaaagcgaagcagag
agcagccaagcatctgccaaagacccggcacctgcagcttctgcaacgcaagtatctgct
actcaggcggaagaaaatatccgtaagagcctgatggtggcgaacgaaaatctgcgcatt
cgtaaaattcaaccatcggttattcctggcatgtatgaagtccagatcatgggcaaaggg
attatttacatggaggagaacggccagtacttcattgatggccaaatgctgcaccttgat
ggcaaaaaaattgttaatgtgaccgacgagtccatgacagggctgcgcaaggaccttctg
gctaccgttaataaagatgatgccattgttttctcgcctaaaggagaggtaaaggccagt
atttccgtattcactgacgtggattgtggctattgtcagaagctgcatcgtgaagtgcct
gcgttgaacgatatgggcattgaagtgcgttatctggcatatccccgcgctggacttaat
tctatgtcctatcaaaaaatcgcttcagcctggtgtgctgacgatcctcgcaaagcgttg
actgcgctgaagaaccgtgaggatattgctatgaacgtatgtgaaggcaacccggtcgcc
agcgaatacgagttgggccagcaaatgggcgttacgggtacccccgccatagttctggat
tctggcgtgctgatccctggttatatgcctgccaaaaacctggctgagcgcattggtgta
acaagcggcagctaa

DBGET integrated database retrieval system