KEGG   Teredinibacter turnerae: TERTU_1163Help
Entry
TERTU_1163        CDS       T00952                                 

Gene name
dsbC
Definition
protein-disulfide isomerase DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ttu  Teredinibacter turnerae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1215619..1216413
Genome map
AA seq 264 aa AA seqDB search
MVALLGLSLAGLISCKSEAESSQASAKDPAPAASATQVSATQAEENIRKSLMVANENLRI
RKIQPSVIPGMYEVQIMGKGIIYMEENGQYFIDGQMLHLDGKKIVNVTDESMTGLRKDLL
ATVNKDDAIVFSPKGEVKASISVFTDVDCGYCQKLHREVPALNDMGIEVRYLAYPRAGLN
SMSYQKIASAWCADDPRKALTALKNREDIAMNVCEGNPVASEYELGQQMGVTGTPAIVLD
SGVLIPGYMPAKNLAERIGVTSGS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtggccctgctgggtttatctctggcaggactgatatcgtgcaaaagcgaagcagag
agcagccaagcatctgccaaagacccggcacctgcagcttctgcaacgcaagtatctgct
actcaggcggaagaaaatatccgtaagagcctgatggtggcgaacgaaaatctgcgcatt
cgtaaaattcaaccatcggttattcctggcatgtatgaagtccagatcatgggcaaaggg
attatttacatggaggagaacggccagtacttcattgatggccaaatgctgcaccttgat
ggcaaaaaaattgttaatgtgaccgacgagtccatgacagggctgcgcaaggaccttctg
gctaccgttaataaagatgatgccattgttttctcgcctaaaggagaggtaaaggccagt
atttccgtattcactgacgtggattgtggctattgtcagaagctgcatcgtgaagtgcct
gcgttgaacgatatgggcattgaagtgcgttatctggcatatccccgcgctggacttaat
tctatgtcctatcaaaaaatcgcttcagcctggtgtgctgacgatcctcgcaaagcgttg
actgcgctgaagaaccgtgaggatattgctatgaacgtatgtgaaggcaacccggtcgcc
agcgaatacgagttgggccagcaaatgggcgttacgggtacccccgccatagttctggat
tctggcgtgctgatccctggttatatgcctgccaaaaacctggctgagcgcattggtgta
acaagcggcagctaa

DBGET integrated database retrieval system