KEGG   Teredinibacter turnerae: TERTU_1165Help
Entry
TERTU_1165        CDS       T00952                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00260  Glycine, serine and threonine metabolism
ttu00750  Vitamin B6 metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01230  Biosynthesis of amino acids
Module
ttu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_1165 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TERTU_1165 (thrC)
Enzymes [BR:ttu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TERTU_1165 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP URO-D
Motif
Other DBs
NCBI-ProteinID: ACR11262
UniProt: C5BR79
Position
1217922..1219337
Genome map
AA seq 471 aa AA seqDB search
MKYISTRGQAPALNFEDVVLTGLATDGGLYVPETLPEFSQEEIASWAGLSYEALALKIIS
PFVEGEIPEADLKRLIAASYKTSADKGFRHEAIAPLVQTGHNEWVLELFQGPTLAFKDFA
LQFLGHLLDYVLKKRDQKVVIMGATSGDTGSAAIEGCRDCENVDIFILHPYQKVSDVQRR
QMTTVLEDNVHNIALQGNFDDCQNMVKASFADQSFLPEGRQLVAVNSINWARIMAQIVYY
FYAGLALGAPHRPVSFSVPTGNFGDIFAGYLAKRMGLPIEQLVIATNSNDILHRCISEND
HSKQALVHSLSPSMDIMVSSNFERMLFDLHGRDGNKIGALMETFKSEGSMVLDDAVLAEA
RALFSSYRVGDDETVDVIRSVFESTEYLLDPHTAIGVQAARQTRRNNSTPMVCLATAHPA
KFPEAVKQAGQTSDPALPFHMQDLFTREERYQVIADDLSQVQLFIRENISG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatatcagcacgcgtgggcaggctcctgcgctcaattttgaagatgtggtttta
accgggctggcgaccgacggcggcctttacgttccagaaacgctaccggagttctcgcag
gaagagatcgcctcgtgggcgggcctcagctacgaagcacttgcattaaaaattatcagt
ccgtttgtagagggcgaaatacctgaagccgacctaaaaaggctcatcgccgcatcatac
aaaaccagtgcagacaagggctttcgtcatgaggcgatcgcacctttggtgcaaaccggg
cacaacgagtgggtgctagagctgttccaagggcctactctggcattcaaagacttcgca
ctgcagtttttggggcacctgcttgattacgtgctgaaaaaacgggatcagaaagtcgta
attatgggtgccacctccggcgataccgggtctgcagcaatcgaaggttgccgtgattgc
gagaatgtggatatttttatccttcacccctatcaaaaagtgtcggatgtgcagcgtcgt
caaatgaccacggtgcttgaagacaacgtgcacaatattgccttgcagggcaactttgac
gattgccagaacatggtgaaggccagttttgcggatcaatcgtttttacctgaagggcgc
cagctggtcgcggtaaactccatcaactgggcgcgcatcatggcgcaaattgtttactac
ttttacgctggcctggcattgggcgcgcctcatcggcctgtgtctttttctgtacctacg
ggaaatttcggcgatatattcgcgggttatcttgccaagcgtatgggcctgccaatcgag
cagctggttattgccaccaacagcaacgacattcttcatcgctgtatcagtgagaacgat
cactcgaagcaagctttggtgcactcgctgtcgcctagtatggatatcatggtttccagt
aactttgaacgtatgttgttcgatttgcacggtagagacggcaacaaaatcggcgctttg
atggaaacatttaaatctgaaggctccatggtgttggatgatgcggtgctggctgaggct
cgtgctttgttcagcagttatcgcgtaggcgatgatgaaacagtcgatgtgattcgatct
gtatttgagtcgaccgaatatctgctcgacccgcacactgcgattggcgtgcaggcggcg
cgtcagacgcgtcgcaataacagtacgcccatggtttgcctagcaactgcccatccggcg
aagttcccagaagcagtaaaacaagcagggcagacctcggaccctgcgctcccgtttcat
atgcaggacctgttcactcgcgaagagcggtatcaggtaattgcagatgatctgtctcag
gttcaattgtttatccgcgaaaacatttcaggctaa

DBGET integrated database retrieval system