KEGG   Teredinibacter turnerae: TERTU_1165Help
Entry
TERTU_1165        CDS       T00952                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TERTU_1165 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_1165 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TERTU_1165 (thrC)
Enzymes [BR:ttu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TERTU_1165 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217922..1219337
Genome map
AA seq 471 aa AA seqDB search
MKYISTRGQAPALNFEDVVLTGLATDGGLYVPETLPEFSQEEIASWAGLSYEALALKIIS
PFVEGEIPEADLKRLIAASYKTSADKGFRHEAIAPLVQTGHNEWVLELFQGPTLAFKDFA
LQFLGHLLDYVLKKRDQKVVIMGATSGDTGSAAIEGCRDCENVDIFILHPYQKVSDVQRR
QMTTVLEDNVHNIALQGNFDDCQNMVKASFADQSFLPEGRQLVAVNSINWARIMAQIVYY
FYAGLALGAPHRPVSFSVPTGNFGDIFAGYLAKRMGLPIEQLVIATNSNDILHRCISEND
HSKQALVHSLSPSMDIMVSSNFERMLFDLHGRDGNKIGALMETFKSEGSMVLDDAVLAEA
RALFSSYRVGDDETVDVIRSVFESTEYLLDPHTAIGVQAARQTRRNNSTPMVCLATAHPA
KFPEAVKQAGQTSDPALPFHMQDLFTREERYQVIADDLSQVQLFIRENISG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatatcagcacgcgtgggcaggctcctgcgctcaattttgaagatgtggtttta
accgggctggcgaccgacggcggcctttacgttccagaaacgctaccggagttctcgcag
gaagagatcgcctcgtgggcgggcctcagctacgaagcacttgcattaaaaattatcagt
ccgtttgtagagggcgaaatacctgaagccgacctaaaaaggctcatcgccgcatcatac
aaaaccagtgcagacaagggctttcgtcatgaggcgatcgcacctttggtgcaaaccggg
cacaacgagtgggtgctagagctgttccaagggcctactctggcattcaaagacttcgca
ctgcagtttttggggcacctgcttgattacgtgctgaaaaaacgggatcagaaagtcgta
attatgggtgccacctccggcgataccgggtctgcagcaatcgaaggttgccgtgattgc
gagaatgtggatatttttatccttcacccctatcaaaaagtgtcggatgtgcagcgtcgt
caaatgaccacggtgcttgaagacaacgtgcacaatattgccttgcagggcaactttgac
gattgccagaacatggtgaaggccagttttgcggatcaatcgtttttacctgaagggcgc
cagctggtcgcggtaaactccatcaactgggcgcgcatcatggcgcaaattgtttactac
ttttacgctggcctggcattgggcgcgcctcatcggcctgtgtctttttctgtacctacg
ggaaatttcggcgatatattcgcgggttatcttgccaagcgtatgggcctgccaatcgag
cagctggttattgccaccaacagcaacgacattcttcatcgctgtatcagtgagaacgat
cactcgaagcaagctttggtgcactcgctgtcgcctagtatggatatcatggtttccagt
aactttgaacgtatgttgttcgatttgcacggtagagacggcaacaaaatcggcgctttg
atggaaacatttaaatctgaaggctccatggtgttggatgatgcggtgctggctgaggct
cgtgctttgttcagcagttatcgcgtaggcgatgatgaaacagtcgatgtgattcgatct
gtatttgagtcgaccgaatatctgctcgacccgcacactgcgattggcgtgcaggcggcg
cgtcagacgcgtcgcaataacagtacgcccatggtttgcctagcaactgcccatccggcg
aagttcccagaagcagtaaaacaagcagggcagacctcggaccctgcgctcccgtttcat
atgcaggacctgttcactcgcgaagagcggtatcaggtaattgcagatgatctgtctcag
gttcaattgtttatccgcgaaaacatttcaggctaa

DBGET integrated database retrieval system