KEGG   Teredinibacter turnerae: TERTU_1165Help
Entry
TERTU_1165        CDS       T00952                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ttu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ttu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217922..1219337
Genome map
AA seq 471 aa AA seqDB search
MKYISTRGQAPALNFEDVVLTGLATDGGLYVPETLPEFSQEEIASWAGLSYEALALKIIS
PFVEGEIPEADLKRLIAASYKTSADKGFRHEAIAPLVQTGHNEWVLELFQGPTLAFKDFA
LQFLGHLLDYVLKKRDQKVVIMGATSGDTGSAAIEGCRDCENVDIFILHPYQKVSDVQRR
QMTTVLEDNVHNIALQGNFDDCQNMVKASFADQSFLPEGRQLVAVNSINWARIMAQIVYY
FYAGLALGAPHRPVSFSVPTGNFGDIFAGYLAKRMGLPIEQLVIATNSNDILHRCISEND
HSKQALVHSLSPSMDIMVSSNFERMLFDLHGRDGNKIGALMETFKSEGSMVLDDAVLAEA
RALFSSYRVGDDETVDVIRSVFESTEYLLDPHTAIGVQAARQTRRNNSTPMVCLATAHPA
KFPEAVKQAGQTSDPALPFHMQDLFTREERYQVIADDLSQVQLFIRENISG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatatcagcacgcgtgggcaggctcctgcgctcaattttgaagatgtggtttta
accgggctggcgaccgacggcggcctttacgttccagaaacgctaccggagttctcgcag
gaagagatcgcctcgtgggcgggcctcagctacgaagcacttgcattaaaaattatcagt
ccgtttgtagagggcgaaatacctgaagccgacctaaaaaggctcatcgccgcatcatac
aaaaccagtgcagacaagggctttcgtcatgaggcgatcgcacctttggtgcaaaccggg
cacaacgagtgggtgctagagctgttccaagggcctactctggcattcaaagacttcgca
ctgcagtttttggggcacctgcttgattacgtgctgaaaaaacgggatcagaaagtcgta
attatgggtgccacctccggcgataccgggtctgcagcaatcgaaggttgccgtgattgc
gagaatgtggatatttttatccttcacccctatcaaaaagtgtcggatgtgcagcgtcgt
caaatgaccacggtgcttgaagacaacgtgcacaatattgccttgcagggcaactttgac
gattgccagaacatggtgaaggccagttttgcggatcaatcgtttttacctgaagggcgc
cagctggtcgcggtaaactccatcaactgggcgcgcatcatggcgcaaattgtttactac
ttttacgctggcctggcattgggcgcgcctcatcggcctgtgtctttttctgtacctacg
ggaaatttcggcgatatattcgcgggttatcttgccaagcgtatgggcctgccaatcgag
cagctggttattgccaccaacagcaacgacattcttcatcgctgtatcagtgagaacgat
cactcgaagcaagctttggtgcactcgctgtcgcctagtatggatatcatggtttccagt
aactttgaacgtatgttgttcgatttgcacggtagagacggcaacaaaatcggcgctttg
atggaaacatttaaatctgaaggctccatggtgttggatgatgcggtgctggctgaggct
cgtgctttgttcagcagttatcgcgtaggcgatgatgaaacagtcgatgtgattcgatct
gtatttgagtcgaccgaatatctgctcgacccgcacactgcgattggcgtgcaggcggcg
cgtcagacgcgtcgcaataacagtacgcccatggtttgcctagcaactgcccatccggcg
aagttcccagaagcagtaaaacaagcagggcagacctcggaccctgcgctcccgtttcat
atgcaggacctgttcactcgcgaagagcggtatcaggtaattgcagatgatctgtctcag
gttcaattgtttatccgcgaaaacatttcaggctaa

DBGET integrated database retrieval system