KEGG   Teredinibacter turnerae: TERTU_1369Help
Entry
TERTU_1369        CDS       T00952                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ttu  Teredinibacter turnerae
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TERTU_1369
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TERTU_1369
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TERTU_1369
Two-component system [BR:ttu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TERTU_1369
Bacterial motility proteins [BR:ttu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TERTU_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422281..1423420
Genome map
AA seq 379 aa AA seqDB search
MAYKVLIVDDSSFFQHRLKEIIGEHPDLEVVGIASNGREAIDKAKQLEPDIISMDYEMPY
LDGVSAVRAIMAERPVPIVMFSSMTYEGATITLEALDAGAVDFIPKNFAEVSRNSAILKK
KLHEKLIGFASNANPAARRNTSDLAAEANERSQRAKERTAALRARMSARSDAAPSSPSAP
VAPSPRPSVRLKGRVKIVAIGASTGGPVALSDIITNLPANFPLPLVVVQHMPENFTRAFA
ERLNRLAQVNVKEAESGDALLPGHVLIAPGGKQMIVDRGGRSVKIIDGDDRVNYKPCVDI
TFASIASNMGGDALAIVLTGMGADGCEGAKLLKSKGAAIWSQDQETSVVYGMPAAVARAG
LSDEVLPLDEVCPRLLSEF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtggcctataaggtgctcatcgtagatgattcgagtttttttcagcatcgcttaaaagaa
attattggcgaacacccggaccttgaagtcgtgggtatcgcgtccaacggccgtgaagcc
attgacaaggcgaagcagttggaacccgatatcatttcgatggattatgaaatgccatac
ctagatggcgtgtctgctgtgcgcgcaattatggctgagcgcccagtgccgattgtgatg
ttttcttcgatgacatacgaaggcgcaactattacgctggaagctctcgatgcgggagcg
gtcgattttattccgaaaaatttcgcggaagtatcgcgaaactcagcgatcctaaagaaa
aaactccacgagaaactgattggctttgccagtaatgccaatcccgcggcacggcgtaat
acgtcggatttagcggcagaggccaatgaacggtctcagcgcgcgaaagagcgtactgcc
gccctgcgcgcacgcatgtctgcaaggtcggatgcggcgccctcgtcgccctctgcaccc
gtagcgccgagtccgcgcccttcagtcaggctcaaaggccgtgtaaaaatcgtagcgata
ggcgcgtctaccggcgggccggttgcgctgtccgacattatcactaacctgcctgcaaat
tttcctctgccactcgtcgtggtacagcacatgccggaaaatttcacccgtgcatttgcc
gagcgccttaatcggctggctcaggtcaacgttaaagaagcggagagcggcgatgcgttg
ttgcctggtcacgttttgattgcgccgggcggtaagcagatgatcgtcgaccgtggtggt
cgcagtgtaaaaattattgatggcgatgatcgtgttaactacaaaccctgtgtcgatatc
acctttgcttccatcgcgtcgaacatggggggagacgcgttggcaattgtgttaacgggt
atgggagctgacggttgcgagggcgcaaaactgcttaagagcaaaggtgcagccatttgg
tcgcaagatcaggaaaccagcgttgtctacggtatgcccgccgctgttgcgcgcgcaggc
ttaagtgatgaagttcttcctttagatgaagtatgcccccgattgttaagcgaattttag

DBGET integrated database retrieval system