KEGG   Teredinibacter turnerae: TERTU_1369Help
Entry
TERTU_1369        CDS       T00952                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ttu  Teredinibacter turnerae
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ttu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ttu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422281..1423420
Genome map
AA seq 379 aa AA seqDB search
MAYKVLIVDDSSFFQHRLKEIIGEHPDLEVVGIASNGREAIDKAKQLEPDIISMDYEMPY
LDGVSAVRAIMAERPVPIVMFSSMTYEGATITLEALDAGAVDFIPKNFAEVSRNSAILKK
KLHEKLIGFASNANPAARRNTSDLAAEANERSQRAKERTAALRARMSARSDAAPSSPSAP
VAPSPRPSVRLKGRVKIVAIGASTGGPVALSDIITNLPANFPLPLVVVQHMPENFTRAFA
ERLNRLAQVNVKEAESGDALLPGHVLIAPGGKQMIVDRGGRSVKIIDGDDRVNYKPCVDI
TFASIASNMGGDALAIVLTGMGADGCEGAKLLKSKGAAIWSQDQETSVVYGMPAAVARAG
LSDEVLPLDEVCPRLLSEF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtggcctataaggtgctcatcgtagatgattcgagtttttttcagcatcgcttaaaagaa
attattggcgaacacccggaccttgaagtcgtgggtatcgcgtccaacggccgtgaagcc
attgacaaggcgaagcagttggaacccgatatcatttcgatggattatgaaatgccatac
ctagatggcgtgtctgctgtgcgcgcaattatggctgagcgcccagtgccgattgtgatg
ttttcttcgatgacatacgaaggcgcaactattacgctggaagctctcgatgcgggagcg
gtcgattttattccgaaaaatttcgcggaagtatcgcgaaactcagcgatcctaaagaaa
aaactccacgagaaactgattggctttgccagtaatgccaatcccgcggcacggcgtaat
acgtcggatttagcggcagaggccaatgaacggtctcagcgcgcgaaagagcgtactgcc
gccctgcgcgcacgcatgtctgcaaggtcggatgcggcgccctcgtcgccctctgcaccc
gtagcgccgagtccgcgcccttcagtcaggctcaaaggccgtgtaaaaatcgtagcgata
ggcgcgtctaccggcgggccggttgcgctgtccgacattatcactaacctgcctgcaaat
tttcctctgccactcgtcgtggtacagcacatgccggaaaatttcacccgtgcatttgcc
gagcgccttaatcggctggctcaggtcaacgttaaagaagcggagagcggcgatgcgttg
ttgcctggtcacgttttgattgcgccgggcggtaagcagatgatcgtcgaccgtggtggt
cgcagtgtaaaaattattgatggcgatgatcgtgttaactacaaaccctgtgtcgatatc
acctttgcttccatcgcgtcgaacatggggggagacgcgttggcaattgtgttaacgggt
atgggagctgacggttgcgagggcgcaaaactgcttaagagcaaaggtgcagccatttgg
tcgcaagatcaggaaaccagcgttgtctacggtatgcccgccgctgttgcgcgcgcaggc
ttaagtgatgaagttcttcctttagatgaagtatgcccccgattgttaagcgaattttag

DBGET integrated database retrieval system