KEGG   Teredinibacter turnerae: TERTU_1620Help
Entry
TERTU_1620        CDS       T00952                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:4.2.1.17 5.3.3.8 1.1.1.35 5.1.2.3)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ttu  Teredinibacter turnerae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERTU_1620 (fadB)
   01212 Fatty acid metabolism
    TERTU_1620 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TERTU_1620 (fadB)
   00650 Butanoate metabolism
    TERTU_1620 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    TERTU_1620 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    TERTU_1620 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TERTU_1620 (fadB)
   00310 Lysine degradation
    TERTU_1620 (fadB)
   00380 Tryptophan metabolism
    TERTU_1620 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TERTU_1620 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TERTU_1620 (fadB)
   00281 Geraniol degradation
    TERTU_1620 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    TERTU_1620 (fadB)
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TERTU_1620 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TERTU_1620 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     TERTU_1620 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     TERTU_1620 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667185..1669347
Genome map
AA seq 720 aa AA seqDB search
MIFDGKAFKLIPLEDGIVELQFDLQGESVNKFSMQAMAELGDALDILESHPGLSGLLFSS
AKEVFIVGADINEFGKVFAGGTDAVKAYNGKTNALFSRLEDLPVPTVVAINGYCLGGGME
ISLACDFRILSHKAKIGLPETKLGIIPGWGGTVRLPRLAGLDVAIDWIASGKDQRPDAAL
RAGVADGVVAPEKLHDAAIKVLRDAISGSLPYLPRRQLKKSPLRINDTEGLLAFEGAKMF
IKGQAGRHYPAPVAAVQSMQNGAKLERDAALAVETELFAELAQGPVAESLVGLFLNDQLL
GKKAKSFIKSAPGEVKKAAVLGAGIMGGGIAYQSAYKGTPVVMKDIATQGLDLGMAEAAK
LLNKQVTRGRIDTAKMAEVLNRIQPTLSYEGFGAVDIVVEAVVENPNIKHAVLTEVEKHL
SDTAVLCSNTSTISIDFLAEPLQRPQNFCGMHFFNPVHAMPLVEVIRGTHTSDSAVATTV
AYASALGKKPVVVKDCPGFLVNRVLFPYFAGFAMLLRDGADFQKVDKVMERWGWPMGPAY
LLDVVGIDTGVHAESVMAEGFPDRMGKSFKAASDVLFEAGRLGQKNEKGFYNYAPDKKGK
PQKVPTEESYELLKPHCAALRDFTDEDIIARMMIPMVTEMARCLEEGIVASVAEADMALV
YGLGFPPFRGGVFRWIDQAGAKVIAEMASSCETLGPLYQLTPGLQKIVETGQTYYPKAEV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgatggcaaggcgttcaagttgatccccctagaggatggaattgtggaactg
caattcgatttacagggtgagtcggttaacaaatttagtatgcaggccatggccgagctg
ggcgatgcgctggatatattggagagccacccaggtttgtcaggcctgcttttcagtagt
gcgaaagaggtgtttattgttggtgccgatatcaatgaattcggcaaagtatttgccggg
ggcaccgatgcagtaaaggcgtataacggcaaaaccaatgcgctgttttcccgcttggaa
gatcttccggtaccgactgttgtcgcgatcaatggctattgtctgggcggcggtatggag
atcagtctcgcctgcgattttcgaattttaagtcacaaagccaaaatcgggctgcctgaa
accaagcttggtattattccgggctggggtggaacggtccgcttgccgcgcctggcgggt
cttgatgttgcgattgactggatcgcctctggcaaggatcagcgaccagatgctgcgctg
cgggcgggcgtcgccgatggcgtggtcgcaccggaaaaactgcatgacgcagcaattaaa
gttttgcgcgatgccatctcgggttcattgccttatcttccccgacggcagctgaaaaag
tcccctcttcgaatcaatgatacggagggcctgctcgcgtttgaaggcgcgaagatgttt
attaaagggcaggcgggccgccattatcccgcgccggtagcggcagttcaatcaatgcag
aatggcgccaaactggagcgggacgctgcgctggcggtagagacggagctgtttgccgaa
ctcgctcaagggccggtggctgagagcctcgttggcctgtttcttaacgatcagcttctc
ggtaaaaaagccaagtcgtttatcaagtccgcgccgggcgaagtaaaaaaagcggcggtg
cttggcgcaggtatcatgggtggcggcatagcctaccaaagtgcttataaaggcacaccg
gtcgtaatgaaagatatcgccacccaggggttggatctcggcatggcagaggcggcgaag
ctgcttaataaacaggttacgcggggccgtatcgacacagccaagatggccgaggtcctc
aacagaattcaacctaccctgagttacgaagggttcggagcggtcgatattgtcgtcgaa
gctgttgttgagaatccaaatatcaagcacgcggtgctcacggaagtagagaaacacctc
tcggacaccgccgtactctgctcgaacacctcgacgatctccattgattttctcgctgag
cctctgcagcggccgcagaacttttgcggtatgcacttctttaaccccgtacacgccatg
cctctcgttgaggttatacgcggcacgcacacctctgattctgcagttgccaccacggtg
gcctatgccagcgcgctaggtaaaaaaccggtggtggttaaagattgccctgggtttctg
gtaaaccgtgtgctcttcccctatttcgcgggttttgcaatgcttttgcgtgacggcgca
gattttcaaaaggttgataaggtaatggagcggtggggctggcccatggggcctgcgtat
ctgcttgacgttgtggggatcgatacgggcgtacacgccgaatcggtgatggctgaaggc
tttcctgaccgcatgggcaagtccttcaaggctgccagcgatgttttgtttgaggcaggc
cgtttgggacagaaaaacgaaaagggcttctacaactacgctccagataaaaagggtaag
ccgcagaaagtacctaccgaagaaagctatgagctactcaaacctcattgcgcggcatta
agggactttactgatgaagatatcatcgcgcggatgatgatacccatggtgaccgagatg
gcccgatgtctcgaggaaggaattgtcgcctcggtggccgaggcggatatggctctggtc
tatggtttagggtttccgccgttccgtggtggggttttccgttggatagatcaagctggc
gccaaagtcattgcagagatggcgtcgtcctgcgaaacgcttggtcctctataccaactc
acgcccgggctgcaaaagattgtggaaactggccaaacttattatccaaaagccgaggtg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system