KEGG   Teredinibacter turnerae: TERTU_1706Help
Entry
TERTU_1706        CDS       T00952                                 

Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ttu  Teredinibacter turnerae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TERTU_1706
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TERTU_1706
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TERTU_1706
Lipid biosynthesis proteins [BR:ttu01004]
 Fatty acid synthase
  Component type
   TERTU_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1779941..1780612
Genome map
AA seq 223 aa AA seqDB search
MRYNLKKVSRFCSPKPLQFAICCVLAWCVSTGAVAKPQAPVILVVGDSLSAAHNLAAEQG
WVALLQERLASPQHKGLQQYQVVNASVGGATTSAALQRLPSLLAEYSPAVVVLEIGGNDG
LQGKPVPYITRNLETLIKLSKQHAAKVVLTGIRIPPNLGQRYTEPFFNQYAALAEKYQLA
LVPFLLEGVATKPELMQADRIHPTAEAQPIILDNLWPILQPLL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacaaccttaaaaaagtatctcgattttgtagtccaaagccacttcagtttgca
atctgttgcgtgttggcctggtgtgtcagcacgggagcggttgcgaagccgcaagcgccc
gtcattctcgtggtgggcgacagtttaagtgcggcccacaatttggctgcggagcaaggc
tgggttgcgctcttgcaggagcgcctggcgtcgccgcaacacaaaggcctccagcaatac
caagtggtcaacgcctcggtgggtggcgccacaacctcggcggcactacagcgcttaccc
tcactcttggcggagtattcgcctgccgtcgttgtgttggaaatcggcggcaatgatggc
ttgcaaggtaaacctgttccttatatcacgcgtaatcttgaaaccctgatcaagctgagc
aagcaacacgctgccaaagttgtactcacggggattcgaattccccctaatcttggccag
agatataccgaacctttctttaaccagtacgcggccttggcagaaaagtatcaactagcg
ctggtgccgttcttactcgaaggcgtagcaaccaagccggagttgatgcaagcggacaga
attcatccaaccgctgaagcacaacctataatcctggataatctgtggccgattctacag
ccgctgctgtga

DBGET integrated database retrieval system