KEGG   Teredinibacter turnerae: TERTU_1752Help
Entry
TERTU_1752        CDS       T00952                                 

Definition
alpha/beta hydrolase family protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ttu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1819326..1820375
Genome map
AA seq 349 aa AA seqDB search
MQNCNTPTLLRTPLVIVYRLGWLLALWSSWPASAVDTLAREAVEAFWQRTPAHQFIAGKD
GVSLAYKVIPRSNALGSVVIFSGRTESFVKYQEFAYEMAQAGYAVYQHDHRGQGLSSRML
ADGRKGHVVEFDDYVVDADTFMRSAAVADAPRPLYLFAHSMGGAIAIRYLATHDNPFAAV
VLGSPMLAPNTGIAGTCQLARAIGYACSTCAATGHTPTPFAKNRLTHSQTRFSWKNEVYE
AFPGSALGAPTFGWVAQACEVREQLQMDAADIRGPLLLLQAGDDKVVLNEPQNAFCAREN
AEGRLVCDGGAPVVIDGARHELLFESDEYRAPVLEIIRGYYASHRPSVE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattgtaatacacccacattattgagaacacctttagtaattgtgtaccgactt
ggttggttactggctttgtggagttcctggccggccagtgcagtcgatactttagctcgc
gaggcagttgaagccttctggcagcgcactccggctcatcagtttatcgcagggaaagat
ggcgtaagcctggcgtacaaggttattcctcgctcaaatgcccttggcagcgtggtgatt
ttctccgggcgtacggaaagttttgttaaataccaagagtttgcgtacgaaatggcacag
gcgggttatgcggtgtaccaacatgaccaccggggtcagggtttgtccagtcgcatgctg
gcagatggacgaaagggccacgttgttgagtttgatgattatgttgtcgatgcggacacc
tttatgcgttcagcggcagtagcggatgcgccacggccgctgtatttgttcgcccattcc
atgggcggggcgattgcgattcgctacctggcaacgcacgacaaccccttcgctgcggtg
gttttagggtcgcccatgctggcgcccaatacgggtattgcaggaacttgtcaactggcc
cgcgcgatcggttatgcctgcagtacatgcgctgccacggggcacacgccgacacccttc
gcaaaaaatcgcctcacccactcacaaacccggttcagctggaaaaatgaggtgtacgaa
gcctttcctggttcagccttaggtgcgccaacattcggttgggtggcgcaggcctgcgag
gtacgtgaacaactgcaaatggatgcggcggatattcgcgggccgctgctgttgctgcaa
gcgggggacgataaggttgtgttgaatgaaccgcaaaatgccttttgcgcgcgcgaaaat
gcggaaggtaggctggtatgcgatggcggagcgcctgtcgttatagacggcgcacggcac
gaattactgtttgaatccgacgaatatcgcgcgcctgtgctcgagataatacgcggttat
tacgcgagccacagaccatcggtagagtaa

DBGET integrated database retrieval system