KEGG   Teredinibacter turnerae: TERTU_1941Help
Entry
TERTU_1941        CDS       T00952                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ttu  Teredinibacter turnerae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ttu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981379..1982410
Genome map
AA seq 343 aa AA seqDB search
MTQPELGPVVLDVDGTTLSESDVNLLQNPWVGGVILFSRNYTNVMQLCGLTAEIRKASPN
IVIAVDHEGGRVQRFGGEFTPIPAMQQLGNLYVKSPVEALALTHETGWLLAAELIACGLD
MSFTPVLDVDDCRSQIIGSRSFGPDPAAVIALSEALTDGLIEAGMSATGKHFPGHGGVVE
DSHLELPVDNRSFDEVARHDLQPFKALLPKLEAIMPAHIHFPQIASEPVGFSSFWLQQVL
REDLGFNGIIFSDDLTMEGAVTAGDYGERTLKALAAGCDSVLICNNPAGAQEALARLDAT
FSTVFPSRLECMRAKRCFEWDSLRGSARAKGVRAQLESLVARS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacctgagttaggcccggttgtactggacgttgacggtacaaccctttctgaa
agtgacgtaaatctcctacaaaacccttgggtaggcggggtaattcttttctcccgtaat
tacaccaatgttatgcagctttgtggattaaccgctgaaattcgcaaggcctcaccgaac
atagtcattgctgttgaccacgaaggtggtcgggtgcagcgctttggtggcgagttcacg
cctattccggcgatgcagcaactgggaaatctctatgttaagtcgccagtagaggcgttg
gcacttacccatgaaacgggctggttgcttgcggcggagctcattgcgtgtgggttggac
atgagctttacgccggtgctggatgtggacgattgccgtagccagattattgggagtcgc
agttttggaccagatcctgcggctgtcattgccctttctgaagcgctaacagatggttta
attgaagctggcatgtcggccacaggcaagcatttccctggccatggtggcgtcgtagaa
gatagccacttggagttaccggtggataatcgtagtttcgacgaggtggccaggcacgat
ctccagccgttcaaagcattactccctaagctcgaagccatcatgcctgcgcatattcat
ttcccccaaatagcctcggaacctgtgggcttttcctcattctggttgcagcaggttctg
cgtgaggaccttgggtttaacggtattatattcagcgatgatctcacaatggagggcgcg
gtcactgcgggtgattatggcgagcgtacactcaaagcattggcggcaggctgcgatagt
gtcttgatctgcaataatccagccggggcgcaagaggcgttggctcgccttgatgcgacc
ttctcgactgtatttccatctcggctcgaatgcatgcgtgccaaacggtgcttcgagtgg
gattctctacgcgggtctgcccgagcgaagggagtacgagctcaactcgagagcttagtt
gcacgtagctag

DBGET integrated database retrieval system