KEGG   Teredinibacter turnerae: TERTU_2256Help
Entry
TERTU_2256        CDS       T00952                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ttu  Teredinibacter turnerae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ttu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ttu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2394861..2395880
Genome map
AA seq 339 aa AA seqDB search
MSNTFDNALAQPQTGMDLEGVSTVAPRKKSRKNARVTLNDPGVQATQKVIAYLTIIVPLL
GLVAALYLAYQNGISQLDIALLVGMYLLTNLGIEMGYHRLFAHRTFKTFGFVHYLLMVFG
QMAGEGGVIYWVATHRRHHIHSDTALDPHSPHTCHTGAEPEELNLRRGLLHAHLGWMVND
KVTNSALFTEDLTRDPLTKAINDLYFPILILGLIIPAAIGGIVTNSWYGALTGFLWGGLV
RMFFVTHSTWLNGSFAHRYGSKPFETGDHSANNFWCAIPTFGASWQNNHHAFPLSAMLGL
KWWQIDIAWYFIWVFEKLGLAWSVRRLTPEHIERKRKVA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacatttgacaacgccctcgcgcagccgcaaaccgggatggatctcgaagga
gtaagcacagtggcaccgcgtaaaaaatcgcggaaaaatgcgcgagttacgcttaacgac
cctggcgtgcaggcgacgcaaaaagttatcgcctacttaactattatcgttcccttgttg
ggtctggttgctgcactctatctggcatatcaaaacggcatttctcaattggatatcgcc
ttgcttgtcggcatgtatttgctgacaaatcttggtattgagatgggctaccaccgtttg
tttgcgcatcgtacatttaaaacatttggctttgttcattatttgctgatggtattcggc
caaatggcgggtgaagggggagtaatatattgggtggccactcaccgtcgtcatcacatc
catagtgacacagcgcttgatccgcattcgccgcatacttgccacaccggggctgagcca
gaagagctaaatttgcgccgcggcctcttgcatgcgcatctcggctggatggtaaacgac
aaggtaactaacagtgcactgttcaccgaagatctcacccgcgacccgctgacaaaagcc
attaacgatctctactttcccattttaattctcggcctgatcataccggcagctatcggc
ggaatcgtcaccaacagctggtacggcgcgcttaccggatttttgtggggtggtttggta
cgcatgttttttgttacgcattctacctggctaaatggctcctttgcacatcgatatggt
tcaaaaccgtttgaaacgggcgatcatagtgcaaataatttttggtgcgcgatcccgacg
tttggtgcttcctggcaaaataatcaccatgcatttccgctttctgcgatgttaggtttg
aagtggtggcaaatcgatatcgcctggtattttatttgggtatttgaaaaacttgggctt
gcgtggtcggtgcgacgtctaacgcccgagcatattgaacgaaagcgcaaagtggcgtag

DBGET integrated database retrieval system