KEGG   Teredinibacter turnerae: TERTU_2314Help
Entry
TERTU_2314        CDS       T00952                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ttu  Teredinibacter turnerae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TERTU_2314
   00500 Starch and sucrose metabolism
    TERTU_2314
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     TERTU_2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2496343..2498742
Genome map
AA seq 799 aa AA seqDB search
MLYFKNKNKSLRYFTNKTGIRLCSPKSNYWHHNYYRYFMNKIIRTLLVFAVTTVSLFLTH
KALALSCSASADTWGSGYVINVTVVNDGSSAIDSWQVELAFDQNPGVTGSWSANIEESGS
TVIASNVSWNGFLESGQSTSFGFQGTHNGNFSLPSCSASSVGIPTPTPSPSPSPGPTVTP
TPTSTPSITPTPTVTPTPVSGELVIEENTPGFCGVDGTIDTNNGGFTGSGFANTSNIAGA
TITWQVQAEFAGNYQLDWRYASASTNGRSAAVSVNGSNLGTVNFPTTGAWDSWTIDSAQL
YLAQGNNTITLIAQTNEGLPNVDSLTLLGNGVNAVDCQTPTPSPSPSPTPSPTPTPPPAD
VTVFIQENANGFCSVDGSIDNENSGYTGSGYANTDNMTGQAINWSVDTSAANYVLEWRYA
NGSTIDRAGTLKVNGNTVRTVSFPTTGDWASWADTRVSVALEEGVNSIRLESSTTEGLAN
IDSLALTGISVAPASCPLPQDCNNITSGTILTVAANGSAQYSSVQSAVNSVSSSNNQQVV
IRIRPGTYYEKLLINRPNITFCGETGAESSTILTYSDGADTAGGTSASYSVSITANDISM
ENLTIQNTRGVGSQGVALRVSAERAQFKNMRFLGYQDTLYTHGGTQYFRDCYVEGSVDYI
FGAATAVFENCHVHSLVNGTAVVAPNTAIERSYGLVFLGGQLTKASAVRDGAVALGRNWG
AYGAATFIGVYLDTHIAPEGWRPMGSNTLDTSRFSEYQNTGPGSATSQRAPQSNQLSASQ
ASQYTVDNILSPWIPSFSQ
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatttcaaaaataaaaataaatcgcttcgctattttactaataaaactggtatc
cgactctgttcgcctaagtctaactattggcaccacaactactacaggtattttatgaat
aaaataatacgcactttactggtgttcgcagtgactaccgttagtcttttcctaacacac
aaagcattagcgttgagctgttccgcttcggcggacacttggggaagtggatacgtcata
aatgtgacggttgtgaatgacggtagtagcgcaattgatagttggcaagttgaactagcg
ttcgatcaaaatcctggggttacaggttcctggagtgcaaatattgaggaatcaggtagc
acagtgattgcctcaaacgtttcctggaacgggtttttagagagcggtcaaagtacaagc
tttggttttcagggtacccataatggcaattttagtttgccatcctgttcggcgtcgagt
gttggtatacctactccaaccccatctcccagcccaagcccaggtccaacagttacgcca
acaccaaccagcacaccttcaatcacgccgaccccaacggttacgcctacgccagtgagt
ggtgagttggttatcgaagaaaatacaccggggttctgcggtgtagatggcacaattgat
acaaacaatggcgggtttaccgggagtggctttgcaaataccagtaacattgctggtgca
acgataacctggcaagtgcaagcggagttcgcgggtaactaccagctcgactggcggtat
gcgagtgcgtctacaaacggtcgcagtgcggcggtcagtgttaatggctcgaacttaggt
acggttaatttcccgacgactggtgcttgggatagctggacaatcgattcagcgcagctc
tatctggctcagggcaataatacgattacgctaatagcacaaacgaacgaaggcctccca
aatgtggattcgctgacactgctgggcaacggcgtcaatgcggtagattgccagaccccg
acgccttcaccctctcctagccctactcctagccctacgccgacaccaccacctgcggac
gtaaccgtgtttattcaggaaaacgctaacggattctgttctgtagacggcagtattgat
aatgaaaattcaggttatacgggaagcggctatgccaatacggacaatatgacggggcaa
gcaataaattggagtgttgatacgagtgcggcaaactatgtgctcgagtggcgctacgca
aacggctccacaatcgaccgcgcgggtacactaaaggtgaatggaaatacggtgcgtacg
gtttcatttccgacgacaggtgattgggccagttgggctgatacccgtgtctctgttgcc
ctcgaggagggtgtaaatagcatccgccttgagtccagcaccaccgaaggtctggctaat
attgattcgctggcactgaccggaattagcgttgctccagcatcatgcccgctgccgcag
gactgcaacaatatcacaagcggaacaatactaacggtggctgccaatggttctgcacaa
tactcatccgtgcaatcggcagtcaacagtgtttcatcatccaataatcagcaggttgtc
ataagaattcgccctggcacctactatgaaaaattactaattaacagacccaatatcact
ttctgtggcgaaacgggtgcagaaagctcgactattctcacctacagcgatggtgctgat
acagccggcggtacttccgccagttacagtgtgtccattactgccaacgatatctcgatg
gaaaacttgacgatccaaaatacccgaggtgttggctcgcaaggcgttgcattgcgagtt
tctgcggagcgcgcccagtttaaaaacatgcgcttcctgggctatcaagataccctttat
acccatggtggaacgcagtacttccgggattgctatgttgaaggtagcgttgactatatt
tttggcgcggccaccgctgtttttgaaaattgccacgtgcacagtttggtgaatggaacg
gcggtcgtcgcaccgaatacggcaatcgaaaggagttacggcctggtatttctcggcggc
caattaactaaagcatctgcggtacgcgacggtgcagtggcgctaggtcgcaattgggga
gcctacggagcagcgacgtttatcggagtctatctcgatacgcatatcgcacccgaaggt
tggcgccccatgggctcgaataccctggatacatcgcgttttagtgaatatcagaatacg
gggcccgggtccgccacttcgcaaagagcaccgcaatcaaatcagcttagcgcttcacag
gcgtcgcaatatacggtcgataatatcctcagcccctggattccgagctttagccagtaa

DBGET integrated database retrieval system