KEGG   Teredinibacter turnerae: TERTU_2494Help
Entry
TERTU_2494        CDS       T00952                                 

Gene name
trpA_1
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TERTU_2494 (trpA_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_2494 (trpA_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TERTU_2494 (trpA_1)
Enzymes [BR:ttu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TERTU_2494 (trpA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2770110..2770925)
Genome map
AA seq 271 aa AA seqDB search
MNRISKRLADIKASGKKALVTYIVHGDPRTDVTLPALHALVEAGTDVIELGVPFSDPMAE
GPVIQRGHERALGNGASLSSAMALVAEFRKTDSETPVVLMGYANPVERMGYKTLAAVAAE
SGVDGLLTVDLPPEEAKDLDAELKAHGLHSIFLIAPTTVDQRIADVTQLAAGFVYYVSLK
GVTGAGHLDIGSVESKLADIRKHTALPVLVGFGIKDKASAQAVGAVSDGVVVGSVLVNAM
GDKAQAGIDEICETLKQLIEPIRAGLDELAQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagaatttcaaaacgtctggccgatataaaagccagcggcaaaaaagccctagta
acctacatcgttcatggcgatccacgcacggatgtaacgctccccgcgttgcatgccttg
gtggaggcaggtaccgatgttatcgaactgggtgtgccgttttccgacccgatggccgaa
gggccagtgattcaacgcggccacgagcgcgccttgggtaatggcgcgagcttgagcagc
gctatggcgctggtcgccgaatttaggaagaccgattccgaaacgccggtggtgctcatg
ggatatgcgaatcctgttgagcgaatgggttataagacgcttgccgcggtagcagccgag
agtggcgtagacggcttacttaccgttgatttgccgccagaagaagcaaaagatctggat
gctgaactgaaggcacatggcttgcacagtatctttctgatcgcaccgacaacggtagat
caacgcattgctgatgtcactcagctggcagcagggtttgtttactatgtgtccctgaag
ggcgtaacgggcgcaggccatttagatattggctcggtggagtccaagctggccgatatt
cgtaaacacactgcgctgccagtgctggttggctttggcattaaggacaaggcctctgcg
caagcggtgggcgcggtctctgatggtgtagtggttggtagtgttcttgtaaatgccatg
ggtgataaggcacaagccggcattgatgaaatttgcgagacgttaaaacaattaattgag
cccatccgcgcaggtttggacgagcttgcccaatag

DBGET integrated database retrieval system