KEGG   Teredinibacter turnerae: TERTU_2495Help
Entry
TERTU_2495        CDS       T00952                                 

Gene name
trpB_1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TERTU_2495 (trpB_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_2495 (trpB_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TERTU_2495 (trpB_1)
Enzymes [BR:ttu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TERTU_2495 (trpB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770942..2772156)
Genome map
AA seq 404 aa AA seqDB search
MTEKKIDFSAFPDERGHFGIYGGRFVSETLMHALDELQEIYDRVKDDPDFQAEFDRDLAH
YVGRPSPLYHAERLSQQMGGAQIYLKREDLNHTGAHKVNNTIGQALLAKFTGKKRVIAET
GAGQHGVATATVAARLGLECVVFMGAEDVKRQALNVYRMKLLGATVVPVTSGSKTLKDAM
NEAMRDWVTNVDDTFYIIGTVAGPHPYPQLVRDFQCVIGREARRQSLEMTGKLPDALVAC
VGGGSNAIGLFHPMLEDESVAMYGVEAGGYGVETGKHAAPLNDGIPGVLHGNRTYLMEDE
NGQIIETHSVSAGLDYPGVGPEHSWLKDVGRVNYVAINDDEAMDAFRKLTRVEGIMPALE
SSHAVAYAMKLAPQMAQDQVIVVNLSGRGDKDILTVAQIDGIEV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagaagaaaattgatttctccgcgtttcccgacgagcgcggccatttcggaatc
tacggtggtcggtttgtctcggaaaccctgatgcatgcgttggatgagttgcaagaaatt
tacgatcgtgtaaaagacgacccggatttccaggccgaatttgatcgcgatctcgcgcac
tatgtcggccgtccctcaccgttgtatcacgccgagcgcctgtcgcagcagatgggcggt
gcgcaaatctatctcaagcgcgaggatcttaatcacaccggtgcgcacaaggtcaataac
accattgggcaagcgctcctagcaaaatttaccggtaaaaagcgtgtaattgccgaaacc
ggagctggtcaacacggtgttgctacagcgaccgttgctgcacgccttgggcttgagtgc
gttgtgtttatgggcgctgaggatgttaagcgtcaggcgcttaacgtataccgtatgaag
cttctcggtgcgactgtcgttccagtcacatccggatcgaagacactcaaagatgcaatg
aatgaggcaatgcgggattgggttaccaatgtcgatgatactttctacatcattggtacc
gtcgcaggcccacatccgtacccgcaactggttcgcgattttcagtgtgtgatcgggcgt
gaagctcggcgtcagagtctggagatgaccggcaagctgcccgacgcgctggtggcgtgt
gtcggtgggggctctaatgctattggcttgtttcatccgatgctggaagacgagagcgtt
gccatgtacggcgtcgaggctggtggttacggtgtcgaaacgggcaagcatgcggcacca
ttgaatgacggcattccaggtgttttacacggcaatcgcacgtatcttatggaagatgag
aatggtcaaattattgagacccactcggtgtccgctggtttggattacccgggcgtaggc
ccagaacattcgtggttaaaagacgtgggcagggttaactatgttgccatcaacgacgat
gaggccatggatgcgttccgcaaattgacacgtgtggaaggcattatgcccgcactggaa
tcgagccacgcagtagcatatgcgatgaaacttgcaccccagatggcgcaggaccaggtg
atcgtggtcaatctatccgggcgcggtgacaaagatattttgaccgttgcgcaaatcgac
ggcattgaagtttag

DBGET integrated database retrieval system