KEGG   Teredinibacter turnerae: TERTU_2495Help
Entry
TERTU_2495        CDS       T00952                                 

Gene name
trpB_1
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TERTU_2495 (trpB_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_2495 (trpB_1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TERTU_2495 (trpB_1)
Enzymes [BR:ttu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TERTU_2495 (trpB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2770942..2772156)
Genome map
AA seq 404 aa AA seqDB search
MTEKKIDFSAFPDERGHFGIYGGRFVSETLMHALDELQEIYDRVKDDPDFQAEFDRDLAH
YVGRPSPLYHAERLSQQMGGAQIYLKREDLNHTGAHKVNNTIGQALLAKFTGKKRVIAET
GAGQHGVATATVAARLGLECVVFMGAEDVKRQALNVYRMKLLGATVVPVTSGSKTLKDAM
NEAMRDWVTNVDDTFYIIGTVAGPHPYPQLVRDFQCVIGREARRQSLEMTGKLPDALVAC
VGGGSNAIGLFHPMLEDESVAMYGVEAGGYGVETGKHAAPLNDGIPGVLHGNRTYLMEDE
NGQIIETHSVSAGLDYPGVGPEHSWLKDVGRVNYVAINDDEAMDAFRKLTRVEGIMPALE
SSHAVAYAMKLAPQMAQDQVIVVNLSGRGDKDILTVAQIDGIEV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagaagaaaattgatttctccgcgtttcccgacgagcgcggccatttcggaatc
tacggtggtcggtttgtctcggaaaccctgatgcatgcgttggatgagttgcaagaaatt
tacgatcgtgtaaaagacgacccggatttccaggccgaatttgatcgcgatctcgcgcac
tatgtcggccgtccctcaccgttgtatcacgccgagcgcctgtcgcagcagatgggcggt
gcgcaaatctatctcaagcgcgaggatcttaatcacaccggtgcgcacaaggtcaataac
accattgggcaagcgctcctagcaaaatttaccggtaaaaagcgtgtaattgccgaaacc
ggagctggtcaacacggtgttgctacagcgaccgttgctgcacgccttgggcttgagtgc
gttgtgtttatgggcgctgaggatgttaagcgtcaggcgcttaacgtataccgtatgaag
cttctcggtgcgactgtcgttccagtcacatccggatcgaagacactcaaagatgcaatg
aatgaggcaatgcgggattgggttaccaatgtcgatgatactttctacatcattggtacc
gtcgcaggcccacatccgtacccgcaactggttcgcgattttcagtgtgtgatcgggcgt
gaagctcggcgtcagagtctggagatgaccggcaagctgcccgacgcgctggtggcgtgt
gtcggtgggggctctaatgctattggcttgtttcatccgatgctggaagacgagagcgtt
gccatgtacggcgtcgaggctggtggttacggtgtcgaaacgggcaagcatgcggcacca
ttgaatgacggcattccaggtgttttacacggcaatcgcacgtatcttatggaagatgag
aatggtcaaattattgagacccactcggtgtccgctggtttggattacccgggcgtaggc
ccagaacattcgtggttaaaagacgtgggcagggttaactatgttgccatcaacgacgat
gaggccatggatgcgttccgcaaattgacacgtgtggaaggcattatgcccgcactggaa
tcgagccacgcagtagcatatgcgatgaaacttgcaccccagatggcgcaggaccaggtg
atcgtggtcaatctatccgggcgcggtgacaaagatattttgaccgttgcgcaaatcgac
ggcattgaagtttag

DBGET integrated database retrieval system