KEGG   Teredinibacter turnerae: TERTU_2519Help
Entry
TERTU_2519        CDS       T00952                                 

Definition
(GenBank) putative succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00020  Citrate cycle (TCA cycle)
ttu00640  Propanoate metabolism
ttu00660  C5-Branched dibasic acid metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
Module
ttu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TERTU_2519
   00640 Propanoate metabolism
    TERTU_2519
   00660 C5-Branched dibasic acid metabolism
    TERTU_2519
Enzymes [BR:ttu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TERTU_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACR13485
UniProt: C5BL83
Position
complement(2796903..2798072)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGVAAETPAEAASAAGILGGDTWVVKAQVHAGGRGKAGGV
KLVKSKAEIEEFAKQWLGKNLVTYQTDENGQPVSRILVETCTDIDQELYLGAVVDRSTRR
IVFMASTEGGVEIEKVAEETPEKILKAIIDPLAGAQPYQARDLAFKLGLEGKQIKQFTQI
FLGLAKMFKEKDLALLEINPLVITKEGDLHCLDAKINIDGNALYRQPALKEMHDPSQEDE
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGQPANFLDVGGGATKERVVE
AFKIILSDESVSAVLINIFGGIVRCDLIAEGVIGAVEEVGVKIPVVCRLEGNNAELGAKV
LADSGLNIIAATSLTDAAEQVVKAAKGDA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcagggtaagcagttgtttgccgaatacggtttgcccgtatcc
aagggcgtcgctgcggaaactcctgccgaagctgcaagtgcagcaggtattctcggtgga
gacacctgggtggtaaaagctcaggtacatgcgggtggtcgcggtaaagctggcggtgtg
aagctggtaaaatccaaggctgaaatcgaagagtttgccaagcaatggctaggcaagaac
ctcgtcacctatcaaaccgacgaaaatggccagcctgttagtcgtatcctggtagaaacc
tgtactgatatcgatcaggagttgtacctgggcgccgtggttgaccgttcgactcgtcgt
atcgttttcatggcttccacagaaggcggcgtagaaatcgagaaagttgctgaagagacc
cctgaaaaaattctgaaagcgattattgatccgctggcaggtgcacagccctaccaagct
cgtgatctcgcattcaaactcggcttggaaggcaaacagatcaagcaatttacccagata
ttcctcggcctggccaagatgtttaaagagaaagatttggctctgctggagatcaatcct
ctggttattaccaaagaaggtgatctgcactgtctggatgccaaaattaacatcgacggc
aatgcactttatcgccaacctgcgctgaaagagatgcacgatccttcgcaagaagacgag
cgcgaagcgcatgcggccaagtgggagctcaactatgtcgcccttgatggcaatatcggc
tgtatggtcaatggtgccggtcttgcgatgggtaccatggatatcgttaagttacacggc
ggtcagcccgcaaacttccttgacgttggtggtggtgcgaccaaagagcgcgtagtcgaa
gcatttaaaattattctgtcagacgaaagcgtatccgctgttctgatcaatatcttcggc
ggtatcgtgcgttgtgatctaattgctgagggtgtcatcggcgctgtcgaagaagttgga
gtgaagattcctgtcgtttgccgccttgaaggtaacaatgcggaacttggcgctaaagtt
cttgctgacagcggcctgaatattattgctgcgaccagccttactgacgcagcagagcag
gtggttaaagcggcgaagggggatgcgtaa

DBGET integrated database retrieval system