KEGG   Teredinibacter turnerae: TERTU_2521Help
Entry
TERTU_2521        CDS       T00952                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00020  Citrate cycle (TCA cycle)
ttu00310  Lysine degradation
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
Module
ttu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TERTU_2521 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    TERTU_2521 (sucB)
Enzymes [BR:ttu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TERTU_2521 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACR13178
UniProt: C5BL85
Position
complement(2799802..2801040)
Genome map
AA seq 412 aa AA seqDB search
MSNEIKVPTFPESVQEGTIATWHKQPGEAFARDEIIVDIETDKVVQEVPAPAAGVMKEIL
KGEGDTVTSNEVIALFNEGEAAADSSEPASPSAEPASAGGSDSGDNSDILAAPAAKKLAQ
EKGIDLAKVKGTGKGGRITKEDVAAHKDEPAAAPAPAAKPAPAAAKSSAPAVAVEGSGER
IEKRVPMTRLRARIAERLLDATQTTAMLTTFNEVNMEPIMKLRSQYKDMFEKVHNGTRLG
FMGFFVKAAVEALRRIPAVNASIDGNDIVYHGYQDIGVAVSTPKGLVVPVLRNTENMSLA
AIENGIRDFGLRARDGKIGIEEMQGGTFTITNGGVFGSLLSTPILNPPQAAILGMHKIQE
RPMAVNGEVKILPMMYLALSYDHRLIDGKEAVSFLVAIKEMIEDPARILLEI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaaataaaagtccctacgtttcctgaatctgttcaggaaggcactattgcc
acatggcacaaacaaccaggcgaagcatttgctcgcgatgaaattattgtcgacatcgaa
actgacaaggttgttcaggaagttcctgctcctgccgcgggtgtgatgaaggaaatattg
aagggggaaggcgacaccgtcaccagtaacgaagttattgctctgtttaacgaaggcgaa
gctgcggcggattccagtgaacccgcgtcgcccagcgctgaacctgcaagtgctggtggc
agcgatagtggcgacaactccgacattttagctgcccccgccgcgaaaaagctcgctcag
gagaaaggaatcgaccttgccaaagttaaaggtactggcaagggaggtcgcatcacaaaa
gaagatgtcgcagcacataaagacgaacctgcagcggcgcctgcgccagcggctaaacca
gcacctgctgcggcaaaatcgtcagcgccggcagttgcagtagaaggtagtggggaaagg
atcgaaaaacgtgtacctatgacgcgcttgcgtgcacgaattgcagagcgtctactggac
gcgacgcaaactacggccatgctgaccacgtttaacgaagtgaacatggaaccgatcatg
aaattgcgttcgcaatataaggatatgttcgaaaaggttcacaatggaacccgtctgggc
tttatgggcttttttgttaaagccgcggttgaagccttgcgcagaatcccagctgttaac
gcatcgatcgacggtaacgacatcgtatatcacggttatcaagatataggtgttgcggtt
tctacgcctaaaggtttagttgttcccgtgttgcgaaacaccgaaaacatgagcctggca
gctatcgaaaacggtattcgtgactttggcctgcgtgcgcgcgatggcaaaatcggtatc
gaggaaatgcagggtggaaccttcaccatcaccaacggcggtgtatttggttcgttgctg
tctacgcctatcctcaatcctccacaggctgcaattttgggtatgcacaaaatccaggag
cgcccgatggcagtaaatggcgaagttaaaattttgccgatgatgtacctcgcgctctct
tatgatcaccgccttatcgacggtaaagaagccgtatccttcctggtcgccattaaggaa
atgatcgaagatccagcgcgcatcctgctggaaatctaa

DBGET integrated database retrieval system