KEGG   Teredinibacter turnerae: TERTU_2525Help
Entry
TERTU_2525        CDS       T00952                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00020  Citrate cycle (TCA cycle)
ttu00190  Oxidative phosphorylation
ttu00650  Butanoate metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
Module
ttu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TERTU_2525 (sdhD)
   00650 Butanoate metabolism
    TERTU_2525 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    TERTU_2525 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACR12129
UniProt: C5BL89
Position
complement(2806592..2806963)
Genome map
AA seq 123 aa AA seqDB search
MVTAITSWGRSGLSDWLIQRFSALVLATYTLVVLGFLILHPQLTYAEWSGFYSQLWMRVF
SLLVLVSTVAHGWIGLWGVLTDYVTSRMIGSSALMLRMIALLIYALISVTFLVWGVEILW
GFK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgccattacaagttggggccgcagtggtctttccgattggttgattcagcgt
tttagcgcgttggtgctagcaacttataccctggtggttttgggttttcttattttgcac
cctcaattgacgtatgcggagtggtcagggttttactcccagttgtggatgcgtgttttt
agcttgctggtgctggtcagcacagtagctcatggatggattggtctgtggggcgtgctg
actgactatgtaacctctcgcatgatcggttcgtctgccttgatgttgcgcatgattgcg
cttcttatatatgcgctcattagtgtcacgtttttggtgtggggcgtggaaatcttgtgg
gggtttaaataa

DBGET integrated database retrieval system