KEGG   Teredinibacter turnerae: TERTU_2639Help
Entry
TERTU_2639        CDS       T00952                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ttu  Teredinibacter turnerae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TERTU_2639
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TERTU_2639
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TERTU_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2911487..2912035
Genome map
AA seq 182 aa AA seqDB search
MKLTTIAGLAFVVASLSNTASAVESCPAFLNQDMKRLHSSETVNLCSLYKEKPLLLVNTA
SHCGYTKQFKGLEALYKKYKDDGFEIVGFASDDFKQAAKSEEEAATVCYKNYGVTFTMLA
PTHVRGKDANPVFAHLNSETEKPGWNFNKYLVSADGKTVKHYGSSTKPMDSALEKDLKKM
LK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaccaccattgccggactggcgtttgttgtcgccagcctaagcaacaccgcg
tcagcagtagaatcctgccctgcttttctcaatcaggacatgaagcgcctgcacagtagc
gaaaccgtgaacctgtgctcgctatacaaagagaaacccttgttgttggtgaataccgcc
agccattgcggctataccaagcaattcaaagggctggaagcgctttacaaaaaatataaa
gacgatggctttgaaatcgtcggtttcgcctccgatgactttaagcaagccgcgaaaagt
gaggaagaagcagcgacggtctgttacaaaaattacggcgttaccttcaccatgctcgcg
cccacacatgtgcgcggaaaagatgccaacccagtgtttgcacacctgaattcagagacg
gaaaagcctggctggaactttaacaagtatctggtttccgccgatgggaaaaccgttaaa
cactacggtagcagtaccaagccaatggattcagcgctagaaaaagacctgaagaaaatg
ctgaagtga

DBGET integrated database retrieval system