KEGG   Teredinibacter turnerae: TERTU_2759Help
Entry
TERTU_2759        CDS       T00952                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ttu  Teredinibacter turnerae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ttu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ttu00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3043776..3044543)
Genome map
AA seq 255 aa AA seqDB search
MDLPTKTVLITGAGSGIGAAVAENLAKKAFNVIVSDLNLSSAEKVSAKINAHGGRARALG
LDVADQQSIESCAATHPEIDILVNNAGLQFVAKLESFPPEKWRLLIDVLLVGPAMLTRAL
LPAMRERGYGRIINVGSIHALVASPFKSAYVAAKHGLLGFSKVLALETADQNITINTICP
SYVKTPLVESQIMQQAREHGMSEADVIDKIMLEPMPKKAFIGMDELVAATIFLISDEARN
MTGQTLTIDGGWTIK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccaccaaaacggtattgatcaccggagctggcagcggaatcggcgccgct
gtcgccgagaatctcgcaaaaaaagccttcaatgttattgtttccgaccttaacctcagc
agcgcggaaaaagtcagtgcgaagatcaatgcgcatggaggccgcgcccgcgccctgggg
ctcgatgttgctgaccagcaaagtatcgagtcttgtgctgctacccaccccgaaattgat
attcttgttaacaatgccggcctgcaatttgtggccaagcttgaatcttttcctcccgaa
aaatggcgcctgcttatcgacgtcctgcttgtaggccctgcaatgctaacgcgggcgcta
ttgcccgccatgcgtgaacgcggttacggccggattattaatgtgggttctatccatgcg
ctggtcgcatcaccctttaaaagtgcctatgtagcggccaagcacggattgctcggtttc
tcaaaagtccttgcgctggaaacggcggatcaaaatattacgataaatacaatatgtccc
tcatacgtgaaaacgccgcttgtcgaaagccaaataatgcagcaggcgagagagcatggt
atgtcagaggcggacgttatcgacaaaatcatgctcgagccgatgccgaagaaagcgttc
atcgggatggatgaacttgttgctgctaccatttttctgatctcagacgaagcgcggaac
atgaccggacaaactctcactatcgacggcggatggacgatcaaatga

DBGET integrated database retrieval system