KEGG   Teredinibacter turnerae: TERTU_2817Help
Entry
TERTU_2817        CDS       T00952                                 

Gene name
trpB_2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ttu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ttu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3105602..3106894
Genome map
AA seq 430 aa AA seqDB search
MISSEQGLFGEFGGRYVPEILRPALCQLEDMYQQLRSDETFWQEYLQLTQEFSGRPTPLT
ALPRLSELLGGAKIWLKREDLNHSGAHKINNVLGQALLVKRMGKQRIIAETGAGQHGLAT
AIIAARMGLQATIYMGSEDVERQYSNVFWMRQLGAEVVPVNHGSCTLKDALDEALRDWAA
SVDDTHYVLGTACGPAPFPELVTYFQRVISQEIRAQAKHQIGALPNAVVACVGGGSNALG
AFCDFLDEPSVRLLGVEAGGRSQQPGQHSIRLHGDLASPGIAQGYKTLFLQNRNGQLGET
HSIAAGLDYVGVSPVLADLVARGRVDATSATDAEVTHAFQLLMRYEGIIPALESSHALAG
GFALAKEMQPQEHVVINLSGRGDKDIFNIAQALPQQEWLDFLEREVARTEQRLKESAQCP
NGEEQYVSNG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagtgaacaagggctttttggcgaattcggcggccgctatgtgccggaaata
ttgcgccccgccctttgccagcttgaagacatgtatcaacagctacgcagcgatgaaacc
ttctggcaagaataccttcagctgacgcaggagttttctggccgcccgacgccgttaacc
gctctacctcgcctgagtgagctgctgggtggcgccaagatctggctcaaacgcgaagac
cttaaccactcaggcgcccacaaaatcaacaatgtgcttggccaagcactattggtgaag
cgcatgggcaaacagcgaataatcgccgaaacgggcgccggtcagcacggtctggccaca
gccataatcgcggctcggatggggttgcaggcgaccatttatatgggcagcgaagacgtt
gagcgtcagtattccaatgtcttctggatgcggcaattaggggcggaagtggttcctgtt
aaccacggctcctgcacgctcaaagatgcgctggacgaagccctgcgggactgggccgcg
agtgttgacgacacccattatgtgttgggcaccgcgtgcggaccggctccctttccggaa
ctggtcacctattttcaacgggtaatctcgcaggaaattcgcgcccaagcgaaacatcaa
attggcgctctgccaaatgccgtggtggcttgcgtcggtggcggctccaatgcgctgggc
gcattttgtgattttctggacgaaccgtcagtacggcttttgggggtcgaagctggaggg
cgcagccaacaaccaggtcagcactctattcgtttgcacggcgatctagcgagcccgggt
atcgcacagggctacaaaacactatttttacaaaaccgtaatgggcaactgggggaaacc
cattcgattgctgcgggtctggattatgtgggcgtatccccggttctagctgatttagtt
gcacggggacgcgtagacgcaacaagcgcgaccgacgctgaggttactcacgcattccag
ctgctgatgcgctacgaaggcatcattcctgcgcttgagtcttcccacgcgttggcaggt
ggatttgccttagcaaaagaaatgcagccacaggagcatgtggtaatcaacctcagcgga
cgcggcgacaaagacattttcaatatcgcgcaagcccttccgcagcaggaatggctggat
tttctggaacgtgaagtcgcccgcacagagcagcgcctgaaagaaagcgcccagtgccct
aacggagaagaacagtatgtttccaacggctaa

DBGET integrated database retrieval system