KEGG   Teredinibacter turnerae: TERTU_2818Help
Entry
TERTU_2818        CDS       T00952                                 

Gene name
trpA_2
Definition
tryptophan synthase, subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ttu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ttu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3106878..3107642
Genome map
AA seq 254 aa AA seqDB search
MFPTANESLKVMSHCVVGFPSLEENEHAIDGLVAAGIRLIELQVPFSDPVADGPVLVNAC
VKALAQGGSFEATLALARKVSRRHPEVTFVLMSYLNPIYQYGIPAAIDEIANAGIEGIIV
PDWPVEAMRPHLLHMEKRGVAPILMVTPNTASARIAEIASASRGMLYVVSRMGVTGSSTH
WGEEFQTYIARVKEHTNLPLAVGFGVRTREDLQALRGRVEVAAFCSQYIEWQAEHGSERA
AERMAQVVQSIQAA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaacggctaatgagtctctaaaagttatgtctcactgcgtggttggcttcccc
agcctcgaagaaaatgaacatgcgatcgatggactggttgccgcggggattcgcctgatc
gaactgcaagttcccttcagcgacccggttgcagatggcccagtcctggtcaatgcctgc
gtgaaagccctcgcgcaaggcggctcattcgaagcaacgctcgcactcgcacgcaaagtc
agccgccgccaccctgaggttacgtttgttttgatgagctatttgaatccaatctatcaa
tacggtattcccgccgccattgatgagattgccaatgcaggcatcgaagggattattgtg
cccgactggccagtggaggctatgcgccctcacctcctccacatggaaaagcgcggggtt
gcgccaattctcatggtcacacccaatacagcgtccgcgcgcatagccgaaatcgcatca
gccagccgaggtatgctgtacgttgtttcccgaatgggtgtcaccgggtcgagcacacat
tggggagaggaattccaaacctacatcgctcgagtaaaagaacacactaaccttcccctg
gcagtgggttttggcgtgcgcactcgcgaggacttgcaagcactgcgcggtcgagtcgag
gtcgccgccttctgctcccaatatatcgaatggcaagcagagcatgggagtgaacgagcc
gctgaacgaatggcacaagttgttcaatccatccaagcagcttga

DBGET integrated database retrieval system