KEGG   Teredinibacter turnerae: TERTU_3167Help
Entry
TERTU_3167        CDS       T00952                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ttu  Teredinibacter turnerae
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ttu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3521733..3523478
Genome map
AA seq 581 aa AA seqDB search
MTDAIQKELKFLVESHLSFIYPNADNGELADRLMAIMELDGSCMKPGVHANSWSQKDIFT
ITYGDSIRRDGEEPLETLHTFFNERLKDVVSGIHILPFFPYSSDDGFSVIDYTRVNDAIG
EWEHIVEIGKEYNLMADLVINHCSSRSGWFDNFKQRKSPGADYFIETDPNTDLSEVVRPR
TTPLLREVETLNGKRHVWCTFSPDQVDLNFANPEVVCEMVGIIKLYLDRGVRTFRLDAVA
FLWKEIGTSCINHPKTHEFVRLFRTLIEHHSPDAIIITETNVPNHENLSYFGNANEAHAV
YNFSLPPLLVNALVTGNSNHLKMWQMSMPPAQMGTFFLNFIASHDGIGLRPAEGLLNEEE
IDALANTMQNFGARISWRTAEGGRPKPYEINVTLFDALQGTVRGPDKWQIERFICAHGIM
FSLEGVPAIYIHSFLATNNYSEGVDLTNHNRTINRYKWDYDELCEKLDDGYSHHCKVLQR
MRELLAIRIKQPAFHPNATQFTLHLGEQVFGFWRQSLKRDQSIFCIHNISDTEVAIPLSS
INLISLNTWEDLVSGEKYTDLHKDLVLGPYDFVWLTNKPGV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatacaaaaagaactcaagttcctggttgaaagccacctgtcattcatt
tatccaaatgctgacaacggtgaactcgcagaccgcctgatggcgattatggagctggat
ggatcctgcatgaagccaggcgtgcatgcgaatagctggagtcagaaagatattttcacc
atcacctatggtgacagtattcgccgtgatggtgaggaaccattggaaaccctgcacacg
ttttttaatgagcggctgaaagacgtggtaagtggtatccacatattgccgtttttccct
tacagctcagacgatggcttttcggttattgactatacgcgggttaacgatgctatcggc
gaatgggaacatattgtcgaaattggcaaagaatacaacctcatggcggatttggttatc
aaccactgttcgagccgtagcggctggttcgacaattttaaacagcgcaagtccccaggc
gccgactattttatcgaaaccgaccctaataccgatctctctgaggttgttcggccacga
accacaccactgttacgcgaagtagaaactctgaacggcaaacgccatgtgtggtgtact
ttcagtccagaccaggttgatctcaacttcgctaatcccgaagttgtgtgtgaaatggtc
ggcatcattaaattgtacctggaccgtggcgtacgcactttccgcctggacgctgttgca
tttctatggaaggaaattggcacgagctgcatcaatcaccccaagacccatgaattcgtc
cgcctgttccgtactttgattgagcaccactcacccgatgccatcataattaccgaaacg
aacgttcccaatcacgagaacctctcctatttcggcaacgccaacgaagcccacgcggtc
tacaatttttccctccctccgttgttagttaacgcgttggtaacggggaatagcaaccac
ttaaagatgtggcagatgagtatgccaccagcgcagatgggtaccttcttccttaatttc
atcgcctctcacgacggaattggcctgcgtccggccgagggtttgctcaacgaagaggaa
atcgatgcgctcgcaaacaccatgcagaatttcggtgcgcgcatctcctggcgaactgcg
gaagggggtaggcctaagccctacgaaattaacgtgaccttgttcgacgctttgcaaggt
accgtgcgggggccagacaagtggcaaatagagcgatttatttgtgcgcacggcattatg
ttttcgctcgaaggcgtgccagccatttacatccacagctttctggccaccaacaattac
agtgagggtgtcgatctcaccaatcacaaccgcacaatcaaccgctataaatgggattac
gacgaactttgcgagaaactggacgacggctacagccatcattgcaaagtgttgcagcgc
atgcgtgagctactggccattcggattaaacagccggcatttcatccaaatgctactcag
tttaccttgcatctgggcgaacaggtatttggcttttggcgacagagtctgaagcgtgat
cagagcattttctgtattcacaatattagcgataccgaagttgccatacccctctcgtcg
atcaacttgatcagcctaaacacttgggaagacttggtgagcggtgaaaagtacaccgat
ttgcataaagatctggtgcttgggccctatgacttcgtttggcttaccaacaaacccggg
gtgtaa

DBGET integrated database retrieval system