KEGG   Teredinibacter turnerae: TERTU_3244Help
Entry
TERTU_3244        CDS       T00952                                 

Definition
(GenBank) hopanoid-associated sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     TERTU_3244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd NmrA Polysacc_synt_2 RmlD_sub_bind KR adh_short DFP GSH-S_N
Motif
Other DBs
NCBI-ProteinID: ACR10905
UniProt: C5BPY4
Position
3594055..3595080
Genome map
AA seq 341 aa AA seqDB search
MINKALVTGASGFLGNAVARALLQQGTAVRVLCRHADNPNLEGLATEQVIGDLTKPSTLA
HAATGCDVLFHVAADYRLWVRDPAAMYAANVDGSLALMRAALACGVERVVYTSSVATLKA
SAQGQIHNESHRGELGDMVGHYKRSKFLAQQAIENLCAEGAPIVLVSPSAPVGPRDIKPT
PTGKILVDSANGKMPAYLDTGLNIAHVDDVAQGHLLAYEHGNTGENYILAGENLLLRDIL
AIIAKLTGRRAPRVELSPNWIKPLAVVNEAIARISGQPPMIPLDGVRMAEKKMFFSHTKA
QAQLGYHPRPAIEAIADALVWFHQQGYIRRAPLDPAVFSSP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaagcgcttgttactggcgccagtggatttctcggtaatgccgtcgcccgc
gcgctactgcaacaaggcacagcggtgcgcgtgctttgccgacacgccgacaaccccaat
ctcgaaggattggcgacagagcaggtgattggcgacctcaccaaaccgtctaccctggcg
cacgccgccactggctgcgacgtgctgtttcacgtcgcagccgactatcgcttgtgggtg
cgcgaccctgcagccatgtacgccgccaacgtcgacggttctttggcgctgatgcgcgcg
gcacttgcctgtggtgtggaacgcgtggtgtacacctccagcgtcgccacacttaaagcc
tccgcacagggccaaatccacaatgaaagccatcgcggcgaactcggcgacatggtgggc
cactacaagcgctccaagtttctcgcccaacaagcgatagaaaatctctgcgcagagggc
gcgccgattgttctggtgagcccgagcgcacctgtcggaccaagagacatcaaaccaacg
cccaccggcaaaatactggtcgactctgctaatggtaaaatgcccgcctatttggacact
gggctcaatatcgcccatgtagacgatgttgcgcagggtcatctcctggcctatgaacac
ggcaacactggcgaaaattacattcttgctggcgaaaatttgttgctgagagacattctg
gcgataatcgcgaagctcaccgggcgcagggctccacgggtcgaattgtcgccaaactgg
atcaaaccgctggcggtcgtcaacgaagcaatcgcccgaataagcgggcaaccaccgatg
attccgctggacggtgtgcgcatggctgaaaaaaaaatgttcttcagccataccaaagca
caggcacaactggggtatcatccccgccctgcaattgaggccatagccgatgccttggtc
tggtttcatcagcaaggctacatccgcagggcaccacttgaccccgcggttttctcaagc
ccctga

DBGET integrated database retrieval system