KEGG   Teredinibacter turnerae: TERTU_3244Help
Entry
TERTU_3244        CDS       T00952                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     TERTU_3244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3594055..3595080
Genome map
AA seq 341 aa AA seqDB search
MINKALVTGASGFLGNAVARALLQQGTAVRVLCRHADNPNLEGLATEQVIGDLTKPSTLA
HAATGCDVLFHVAADYRLWVRDPAAMYAANVDGSLALMRAALACGVERVVYTSSVATLKA
SAQGQIHNESHRGELGDMVGHYKRSKFLAQQAIENLCAEGAPIVLVSPSAPVGPRDIKPT
PTGKILVDSANGKMPAYLDTGLNIAHVDDVAQGHLLAYEHGNTGENYILAGENLLLRDIL
AIIAKLTGRRAPRVELSPNWIKPLAVVNEAIARISGQPPMIPLDGVRMAEKKMFFSHTKA
QAQLGYHPRPAIEAIADALVWFHQQGYIRRAPLDPAVFSSP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaagcgcttgttactggcgccagtggatttctcggtaatgccgtcgcccgc
gcgctactgcaacaaggcacagcggtgcgcgtgctttgccgacacgccgacaaccccaat
ctcgaaggattggcgacagagcaggtgattggcgacctcaccaaaccgtctaccctggcg
cacgccgccactggctgcgacgtgctgtttcacgtcgcagccgactatcgcttgtgggtg
cgcgaccctgcagccatgtacgccgccaacgtcgacggttctttggcgctgatgcgcgcg
gcacttgcctgtggtgtggaacgcgtggtgtacacctccagcgtcgccacacttaaagcc
tccgcacagggccaaatccacaatgaaagccatcgcggcgaactcggcgacatggtgggc
cactacaagcgctccaagtttctcgcccaacaagcgatagaaaatctctgcgcagagggc
gcgccgattgttctggtgagcccgagcgcacctgtcggaccaagagacatcaaaccaacg
cccaccggcaaaatactggtcgactctgctaatggtaaaatgcccgcctatttggacact
gggctcaatatcgcccatgtagacgatgttgcgcagggtcatctcctggcctatgaacac
ggcaacactggcgaaaattacattcttgctggcgaaaatttgttgctgagagacattctg
gcgataatcgcgaagctcaccgggcgcagggctccacgggtcgaattgtcgccaaactgg
atcaaaccgctggcggtcgtcaacgaagcaatcgcccgaataagcgggcaaccaccgatg
attccgctggacggtgtgcgcatggctgaaaaaaaaatgttcttcagccataccaaagca
caggcacaactggggtatcatccccgccctgcaattgaggccatagccgatgccttggtc
tggtttcatcagcaaggctacatccgcagggcaccacttgaccccgcggttttctcaagc
ccctga

DBGET integrated database retrieval system