KEGG   Teredinibacter turnerae: TERTU_3261Help
Entry
TERTU_3261        CDS       T00952                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00010  Glycolysis / Gluconeogenesis
ttu00051  Fructose and mannose metabolism
ttu00562  Inositol phosphate metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
ttu01230  Biosynthesis of amino acids
Module
ttu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttu_M00002  Glycolysis, core module involving three-carbon compounds
ttu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_3261 (tpiA)
   00051 Fructose and mannose metabolism
    TERTU_3261 (tpiA)
   00562 Inositol phosphate metabolism
    TERTU_3261 (tpiA)
Enzymes [BR:ttu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TERTU_3261 (tpiA)
Exosome [BR:ttu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TERTU_3261 (tpiA)
  Exosomal proteins of bladder cancer cells
   TERTU_3261 (tpiA)
  Exosomal proteins of melanoma cells
   TERTU_3261 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACR13306
UniProt: C5BPZ9
Position
complement(3611568..3612308)
Genome map
AA seq 246 aa AA seqDB search
MRRPIVIGNWKMNGDYAANRELLTGLVEQWTGVHQAEVAVCPPFVYLAQAAELLENTNIG
FGSQDISKQASGAYTGEVSGPMLSDVGCRYALVGHSERREYHGETSQLVAEKFQAALDNG
LIPVLCVGESLEDREAGKTFDVVGAQLLAVIEHCGLAGVAKGIIAYEPIWAIGTGKTATP
EMAQDVHSYIREVMGPEGDSVRILYGGSVKPDSAEGLFGQKDIDGALVGGASLNADDFVA
ICRAAE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtccgatcgtaattggtaattggaaaatgaatggcgactatgccgccaatcgt
gagttgctcactggtcttgtagagcagtggacaggagtacaccaggcggaagttgctgtg
tgcccaccgttcgtctatctggctcaggccgccgaactgttggaaaacaccaacattggt
tttggttctcaggacatcagcaagcaagcatccggtgcttacaccggtgaagtttccggt
cctatgttgtccgacgtaggttgtcgttacgcgctggtaggtcactccgagcgtcgcgaa
taccatggcgaaacctctcaattggtagcggaaaaattccaggctgcactggataacggt
ctcatccccgtactgtgtgtaggcgagtctctcgaagaccgcgaggctggtaaaacattt
gatgtggtcggtgcccagctgttggccgttatcgaacactgtggcttggccggtgttgcc
aaaggcattattgcgtatgagcctatttgggctatcggcactggcaaaacagccacgccg
gaaatggcgcaggatgttcatagctacattcgtgaagttatggggccggaaggtgattca
gtgcgtatcttgtacggcggtagtgtgaagccggattccgctgaaggtctgtttggtcaa
aaagatattgacggtgctttggtaggcggtgcctccttgaatgccgatgactttgtcgct
atttgtcgagcggcagagtaa

DBGET integrated database retrieval system