KEGG   Teredinibacter turnerae: TERTU_3261Help
Entry
TERTU_3261        CDS       T00952                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttu  Teredinibacter turnerae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TERTU_3261 (tpiA)
   01230 Biosynthesis of amino acids
    TERTU_3261 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_3261 (tpiA)
   00051 Fructose and mannose metabolism
    TERTU_3261 (tpiA)
   00562 Inositol phosphate metabolism
    TERTU_3261 (tpiA)
Enzymes [BR:ttu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TERTU_3261 (tpiA)
Exosome [BR:ttu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TERTU_3261 (tpiA)
  Exosomal proteins of bladder cancer cells
   TERTU_3261 (tpiA)
  Exosomal proteins of melanoma cells
   TERTU_3261 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3611568..3612308)
Genome map
AA seq 246 aa AA seqDB search
MRRPIVIGNWKMNGDYAANRELLTGLVEQWTGVHQAEVAVCPPFVYLAQAAELLENTNIG
FGSQDISKQASGAYTGEVSGPMLSDVGCRYALVGHSERREYHGETSQLVAEKFQAALDNG
LIPVLCVGESLEDREAGKTFDVVGAQLLAVIEHCGLAGVAKGIIAYEPIWAIGTGKTATP
EMAQDVHSYIREVMGPEGDSVRILYGGSVKPDSAEGLFGQKDIDGALVGGASLNADDFVA
ICRAAE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtccgatcgtaattggtaattggaaaatgaatggcgactatgccgccaatcgt
gagttgctcactggtcttgtagagcagtggacaggagtacaccaggcggaagttgctgtg
tgcccaccgttcgtctatctggctcaggccgccgaactgttggaaaacaccaacattggt
tttggttctcaggacatcagcaagcaagcatccggtgcttacaccggtgaagtttccggt
cctatgttgtccgacgtaggttgtcgttacgcgctggtaggtcactccgagcgtcgcgaa
taccatggcgaaacctctcaattggtagcggaaaaattccaggctgcactggataacggt
ctcatccccgtactgtgtgtaggcgagtctctcgaagaccgcgaggctggtaaaacattt
gatgtggtcggtgcccagctgttggccgttatcgaacactgtggcttggccggtgttgcc
aaaggcattattgcgtatgagcctatttgggctatcggcactggcaaaacagccacgccg
gaaatggcgcaggatgttcatagctacattcgtgaagttatggggccggaaggtgattca
gtgcgtatcttgtacggcggtagtgtgaagccggattccgctgaaggtctgtttggtcaa
aaagatattgacggtgctttggtaggcggtgcctccttgaatgccgatgactttgtcgct
atttgtcgagcggcagagtaa

DBGET integrated database retrieval system